C13orf15 (RGCC) (NM_014059) Human Recombinant Protein

RGC32 protein,

Recombinant protein of human chromosome 13 open reading frame 15 (C13orf15)

Product Info Summary

SKU: PROTQ9H4X1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C13orf15 (RGCC) (NM_014059) Human Recombinant Protein

View all RGC32 recombinant proteins

SKU/Catalog Number

PROTQ9H4X1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 13 open reading frame 15 (C13orf15)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C13orf15 (RGCC) (NM_014059) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H4X1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.4 kDa

Amino Acid Sequence

MKQPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM

Validation Images & Assay Conditions

Gene/Protein Information For RGCC (Source: Uniprot.org, NCBI)

Gene Name

RGCC

Full Name

Regulator of cell cycle RGCC

Weight

14.4 kDa

Alternative Names

bA157L14.2; chromosome 13 open reading frame 15; KIAA0564; RGC-32MGC87338; RGC32response gene to complement 32 protein RGCC C13orf15, RGC-32, RGC32, bA157L14.2 regulator of cell cycle regulator of cell cycle RGCC|response gene to complement 32 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RGCC, check out the RGCC Infographic

RGCC infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RGCC: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H4X1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C13orf15 (RGCC) (NM_014059) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C13orf15 (RGCC) (NM_014059) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C13orf15 (RGCC) (NM_014059) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H4X1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.