BMP6 (NM_001718) Human Recombinant Protein

BMP-6 protein,

Product Info Summary

SKU: PROTP22004
Size: 20 µg
Source: HEK293T

Product Name

BMP6 (NM_001718) Human Recombinant Protein

View all BMP-6 recombinant proteins

SKU/Catalog Number

PROTP22004

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens bone morphogenetic protein 6 (BMP6)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BMP6 (NM_001718) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP22004)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

57 kDa

Amino Acid Sequence

MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLPRGEPPPGRLKSAPLFMLDLYNALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAHPLNRKSLLAPGSGSGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH

Validation Images & Assay Conditions

Gene/Protein Information For BMP6 (Source: Uniprot.org, NCBI)

Gene Name

BMP6

Full Name

Bone morphogenetic protein 6

Weight

57 kDa

Superfamily

TGF-beta family

Alternative Names

BMP6; BMP-6; bone morphogenetic protein 6; vegetal related growth factor (TGFB-related); vegetal-related (TGFB related) cytokine; VG-1-R; VG-1-related protein; Vg1-related sequence; VGR; VGR1; Vgr-1 BMP6 VGR, VGR1 bone morphogenetic protein 6 bone morphogenetic protein 6|VG-1-R|VG-1-related protein|vegetal related growth factor (TGFB-related)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BMP6, check out the BMP6 Infographic

BMP6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BMP6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP22004

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BMP6 (NM_001718) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BMP6 (NM_001718) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BMP6 (NM_001718) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP22004
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.