BEGAIN (NM_020836) Human Recombinant Protein

BEGAIN protein,

Recombinant protein of human brain-enriched guanylate kinase-associated homolog (rat) (BEGAIN)

Product Info Summary

SKU: PROTQ9BUH8
Size: 20 µg
Source: HEK293T

Product Name

BEGAIN (NM_020836) Human Recombinant Protein

View all BEGAIN recombinant proteins

SKU/Catalog Number

PROTQ9BUH8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human brain-enriched guanylate kinase-associated homolog (rat) (BEGAIN)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

BEGAIN (NM_020836) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BUH8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

64.6 kDa

Amino Acid Sequence

MEKLSALQEQKGELRKRLSYTTHKLEKLETEFDSTRHYLEIELRRAQEELEKVTEKLRRIQSNYMALQRINQELEDKLYRMGQHYEEEKRALSHEIVALNSHLLEAKVTIDKLSEDNELYRKDCNLAAQLLQCSQTYGRVHKVSELPSDFQERVSLHMEKHGCSLPSPLCHPAYADSVPTCVIAKVLEKPDPASLSSRLSDASARDLAFCDGVEKPGPRPPYKGDIYCSDTALYCPEERRRDRRPSVDAPVTDVGFLRAQNSTDSAAEEEEEAEAAAFPAGFQHEAFPSYAGSLPTSSSYSSFSATSEEKEHAQASTLTASQQAIYLNSRDELFDRKPPATTYEGSPRFAKATAAVAAPLEAEVAPGFGRTMSPYPAETFRFPASPGPQQALMPPNLWSLRAKPGTARLPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCSFSERYYGGAGGSPGKKADGRASPLYASYKADSFSEGDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGYAPSEGGDGDRLGVQLCGTASSPEPEQGSRDSLEPSSMEASPEMHPAARLSPQQAFPRTGGSGLSRKDSLTKAQLYGTLLN

Validation Images & Assay Conditions

Gene/Protein Information For BEGAIN (Source: Uniprot.org, NCBI)

Gene Name

BEGAIN

Full Name

Brain-enriched guanylate kinase-associated protein

Weight

64.6 kDa

Alternative Names

brain-enriched guanylate kinase-associated homolog (rat); KIAA1446brain-enriched guanylate kinase-associated protein BEGAIN brain enriched guanylate kinase associated brain-enriched guanylate kinase-associated protein|brain-enriched guanylate kinase-associated homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BEGAIN, check out the BEGAIN Infographic

BEGAIN infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BEGAIN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BUH8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used BEGAIN (NM_020836) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For BEGAIN (NM_020836) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for BEGAIN (NM_020836) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BUH8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.