Click image to see more details
Product Info Summary
| SKU: | PB9746 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SMC3 Antibody Picoband®
SKU/Catalog Number
PB9746
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SMC3 Antibody Picoband® catalog # PB9746. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SMC3 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9746)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3, identical to the related mouse sequence.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9746 is reactive to SMC3 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
140 kDa
Calculated molecular weight
141542 MW
Background of SMC3
Structural maintenance of chromosomes 3, also known as SMC3, is a human gene. This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9746 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Positive Control
WB: Rat Brain Tissue, Rat Liver Tissue, Rat Testis Tissue, HELA Whole Cell, A549 Whole Cell, MCF-7 Whole Cell, NIH3T3 Whole Cell
IHC: mouse intestine tissue, rat kidney tissue, human intestinal cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of SMC3 using anti-SMC3 antibody (PB9746).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: Rat Brain Tissue Lysate at 50ug,
Lane 2: Rat Liver Tissue Lysate at 50ug,
Lane 3: Rat Testis Tissue Lysate at 50ug,
Lane 4: HELA Whole Cell Lysate at 40ug,
Lane 5: A549 Whole Cell Lysate at 40ug,
Lane 6: MCF-7 Whole Cell Lysate at 40ug,
Lane 7: NIH3T3 Whole Cell Lysate at 40ug.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SMC3 antigen affinity purified polyclonal antibody (Catalog # PB9746) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SMC3 at approximately 140 kDa. The expected band size for SMC3 is at 140 kDa.
Click image to see more details
Figure 2. IHC analysis of SMC3 using anti-SMC3 antibody (PB9746).
SMC3 was detected in a paraffin-embedded section of mouse intestine tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-SMC3 Antibody (PB9746) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of SMC3 using anti-SMC3 antibody (PB9746).
SMC3 was detected in a paraffin-embedded section of rat kidney tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-SMC3 Antibody (PB9746) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of SMC3 using anti-SMC3 antibody (PB9746).
SMC3 was detected in a paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-SMC3 Antibody (PB9746) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For SMC3 (Source: Uniprot.org, NCBI)
Gene Name
SMC3
Full Name
Structural maintenance of chromosomes protein 3
Weight
141542 MW
Superfamily
SMC family
Alternative Names
Structural maintenance of chromosomes protein 3;SMC protein 3;SMC-3;Basement membrane-associated chondroitin proteoglycan;Bamacan;Chondroitin sulfate proteoglycan 6;Chromosome-associated polypeptide;hCAP;SMC3;BAM, BMH, CSPG6, SMC3L1; SMC3 BAM, BMH, CDLS3, CSPG6, HCAPL1, SMC3 structural maintenance of chromosomes 3 structural maintenance of chromosomes protein 3|SMC protein 3|basement membrane-associated chondroitin proteoglycan|chondroitin sulfate proteoglycan 6 (bamacan)|chromosome-associated polypeptide
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SMC3, check out the SMC3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SMC3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SMC3 Antibody Picoband® (PB9746)
Hello CJ!
No publications found for PB9746
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SMC3 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-SMC3 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-SMC3 Antibody Picoband®
Question
We are currently using anti-SMC3 antibody PB9746 for rat tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on canine tissues as well?
Verified Customer
Verified customer
Asked: 2020-03-24
Answer
The anti-SMC3 antibody (PB9746) has not been tested for cross reactivity specifically with canine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-03-24
Question
Is there a BSA free version of anti-SMC3 antibody PB9746 available?
Verified Customer
Verified customer
Asked: 2020-03-06
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-SMC3 antibody PB9746 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-03-06
Question
Is this PB9746 anti-SMC3 antibody reactive to the isotypes of SMC3?
Verified Customer
Verified customer
Asked: 2019-10-16
Answer
The immunogen of PB9746 anti-SMC3 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3 (1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-10-16
Question
Please see the WB image, lot number and protocol we used for brain using anti-SMC3 antibody PB9746. Please let me know if you require anything else.
C. Lewis
Verified customer
Asked: 2015-11-23
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2015-11-23
