Click image to see more details
Product Info Summary
| SKU: | A00251 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband®
SKU/Catalog Number
A00251
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband® catalog # A00251. Tested in WB applications. This antibody reacts with Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00251)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse Ace, which shares 70.3% and 91.9% amino acid (aa) sequence identity with human and rat Ace, respectively.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00251 is reactive to Ace in Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
180 kDa
Calculated molecular weight
149.715kDa
Background of ACE/CD143
Angiotensin I converting enzyme (ACE), also called DCP or CD143 is a zinc-containing dipeptidyl carboxypeptidase widely distributed in mammalian tissues and is thought to play a critical role in blood pressure regulation. This gene is mapped to 17q23.3. This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00251 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Positive Control
WB: mouse lung tissue, mouse testis tissue, mouse stomach tissue, rat lung tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Ace using anti-Ace antibody (A00251).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: mouse lung tissue lysates,
Lane 2: mouse testis tissue lysates,
Lane 3: mouse stomach tissue lysates,
Lane 4: rat lung tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Ace antigen affinity purified polyclonal antibody (Catalog # A00251) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Ace at approximately 180KD. The expected band size for Ace is at 150KD.
Protein Target Info & Infographic
Gene/Protein Information For Ace (Source: Uniprot.org, NCBI)
Gene Name
Ace
Full Name
Angiotensin-converting enzyme
Weight
149.715kDa
Superfamily
peptidase M2 family
Alternative Names
Angiotensin-converting enzyme; ACE; Dipeptidyl carboxypeptidase I; Kininase II; CD143; Angiotensin-converting enzyme, soluble form; Ace; Dcp1 ACE ACE1, CD143, DCP, DCP1 angiotensin I converting enzyme angiotensin-converting enzyme|CD143 |angiotensin I converting enzyme (peptidyl-dipeptidase A) 1|carboxycathepsin|dipeptidyl carboxypeptidase 1|dipeptidyl carboxypeptidase I|kininase II|peptidase P
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on Ace, check out the Ace Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Ace: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband® (A00251)
Hello CJ!
A00251 has been cited in 2 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Telmisartan protects chronic intermittent hypoxic mice via modulating cardiac renin-angiotensin system activity
Aliskiren has chondroprotective efficacy in a rat model of osteoarthritis through suppression of the local renin-angiotensin system
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband®
Question
I was wanting to use your anti-Angiotensin Converting Enzyme 1/Ace antibody for WB for rat brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat brain identification?
Verified Customer
Verified customer
Asked: 2020-04-23
Answer
As indicated on the product datasheet, A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody has been validated for WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-04-23
Question
Will A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-04-06
Answer
It shows on the product datasheet, A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-04-06
Question
you antibody to test anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 on rat brain for research purposes, then I may be interested in using anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-12-06
Answer
The products we sell, including anti-Angiotensin Converting Enzyme 1/Ace antibody A00251, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-12-06
Question
Would anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 work for WB with brain?
Verified Customer
Verified customer
Asked: 2019-11-22
Answer
According to the expression profile of brain, ACE is highly expressed in brain. So, it is likely that anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 will work for WB with brain.
Boster Scientific Support
Answered: 2019-11-22
Question
Is this A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody reactive to the isotypes of ACE?
Verified Customer
Verified customer
Asked: 2019-11-06
Answer
The immunogen of A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody is A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-11-06
Question
My team were well pleased with the WB result of your anti-Angiotensin Converting Enzyme 1/Ace antibody. However we have observed positive staining in testis angiotensin-converting enzyme using this antibody. Is that expected? Could you tell me where is ACE supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-10-23
Answer
From literature, testis does express ACE. Generally ACE expresses in angiotensin-converting enzyme, soluble form:, cell membrane. Regarding which tissues have ACE expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 16625196
Liver, Pubmed ID: 19159218
Lung, Pubmed ID: 2558109
Plasma, Pubmed ID: 16335952
Testis, Pubmed ID: 14702039
Umbilical vein endothelial cell, Pubmed ID: 9642152
Boster Scientific Support
Answered: 2019-10-23
Question
I have attached the WB image, lot number and protocol we used for brain using anti-Angiotensin Converting Enzyme 1/Ace antibody A00251. Please let me know if you require anything else.
J. Jha
Verified customer
Asked: 2019-07-01
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-07-01
Question
Is a blocking peptide available for product anti-Angiotensin Converting Enzyme 1/Ace antibody (A00251)?
Verified Customer
Verified customer
Asked: 2019-06-14
Answer
We do provide the blocking peptide for product anti-Angiotensin Converting Enzyme 1/Ace antibody (A00251). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-06-14
Question
I was wanting to use using your anti-Angiotensin Converting Enzyme 1/Ace antibody for positive regulation of protein tyrosine kinase activity studies. Has this antibody been tested with western blotting on testis tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-06-12
Answer
Thank you for your inquiry. This A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody is tested on mouse lung tissue, testis tissue, stomach tissue, rat lung tissue. It is guaranteed to work for WB in mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-06-12
Question
We are currently using anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 for mouse tissue, and we are content with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it true that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2018-12-14
Answer
The anti-Angiotensin Converting Enzyme 1/Ace antibody (A00251) has not been tested for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-12-14
Question
We have been able to see staining in mouse brain. What should we do? Is anti-Angiotensin Converting Enzyme 1/Ace antibody supposed to stain brain positively?
Verified Customer
Verified customer
Asked: 2018-10-15
Answer
According to literature brain does express ACE. According to Uniprot.org, ACE is expressed in testis, brain, lung, umbilical vein endothelial cell, plasma, liver, among other tissues. Regarding which tissues have ACE expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 16625196
Liver, Pubmed ID: 19159218
Lung, Pubmed ID: 2558109
Plasma, Pubmed ID: 16335952
Testis, Pubmed ID: 14702039
Umbilical vein endothelial cell, Pubmed ID: 9642152
Boster Scientific Support
Answered: 2018-10-15
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-Angiotensin Converting Enzyme 1/Ace antibody A00251. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2018-02-19
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-02-19
Question
I see that the anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 works with WB, what is the protocol used to produce the result images on the product page?
J. Lewis
Verified customer
Asked: 2017-07-14
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2017-07-14
Question
I have a question about product A00251, anti-Angiotensin Converting Enzyme 1/Ace antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
H. Zhang
Verified customer
Asked: 2016-09-02
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2016-09-02
Question
Do you have a BSA free version of anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 available?
E. Johnson
Verified customer
Asked: 2014-02-04
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2014-02-04
