SR1 (SRI) (NM_003130) Human Recombinant Protein

SR1 protein,

Product Info Summary

SKU: PROTP30626
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SR1 (SRI) (NM_003130) Human Recombinant Protein

View all SR1 recombinant proteins

SKU/Catalog Number

PROTP30626

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sorcin (SRI), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SR1 (SRI) (NM_003130) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP30626)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.5 kDa

Amino Acid Sequence

MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV

Validation Images & Assay Conditions

Gene/Protein Information For SRI (Source: Uniprot.org, NCBI)

Gene Name

SRI

Full Name

Sorcin

Weight

21.5 kDa

Alternative Names

calcium binding protein amplified in mutlidrug-resistant cells; CP22; CP-22; FLJ26259,22 kDa protein; H_RG167B05.1; SCN; sorcin; V19 SRI CP-22, CP22, SCN, V19 sorcin sorcin|22 kDa protein|H_RG167B05.1|calcium binding protein amplified in mutlidrug-resistant cells

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SRI, check out the SRI Infographic

SRI infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SRI: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP30626

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SR1 (SRI) (NM_003130) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SR1 (SRI) (NM_003130) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SR1 (SRI) (NM_003130) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP30626
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.