Click image to see more details
Product Info Summary
| SKU: | PB9442 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SOD2 Antibody Picoband®
View all SOD2/Mn-SOD Antibodies
SKU/Catalog Number
PB9442
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SOD2 Antibody Picoband® catalog # PB9442. Tested in IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SOD2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9442)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2, different from the related mouse sequence by one amino acid, and from the related rat sequence by four amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9442 is reactive to SOD2 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
24 kDa
Calculated molecular weight
24722 MW
Background of SOD2/Mn-SOD
SOD2 (Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9442 is guaranteed for IHC, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat
Immunocytochemistry, 0.5-1μg/ml
Western blot, 0.1-0.5μg/ml
Positive Control
WB: Human HepG2 whole cell, rat liver tissue, rat lung tissue, mouse liver tissue, mouse lung tissue
IHC: human mammary cancer tissue
ICC: A549 Cell, SMMC-7721 Cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of SOD2 using anti-SOD2 antibody (PB9442).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: Human HepG2 whole cell lysates,
Lane 2: rat liver tissue lysates,
Lane 3: rat lung tissue lysates,
Lane 4: mouse liver tissue lysates,
Lane 5: mouse lung tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SOD2 antigen affinity purified polyclonal antibody (Catalog # PB9442) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SOD2 at approximately 24 kDa. The expected band size for SOD2 is at 25 kDa.
Click image to see more details
Figure 2. IHC analysis of SOD2 using anti-SOD2 antibody (PB9442).
SOD2 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-SOD2 Antibody (PB9442) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of SOD2 using anti-SOD2 antibody (PB9442).
SOD2 was detected in immunocytochemical section of A549 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 1μg/ml rabbit anti-SOD2 Antibody (PB9442) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of SOD2 using anti-SOD2 antibody (PB9442).
SOD2 was detected in immunocytochemical section of SMMC-7721 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 1μg/ml rabbit anti-SOD2 Antibody (PB9442) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For SOD2 (Source: Uniprot.org, NCBI)
Gene Name
SOD2
Full Name
Superoxide dismutase [Mn], mitochondrial
Weight
24722 MW
Superfamily
iron/manganese superoxide dismutase family
Alternative Names
Superoxide dismutase [Mn], mitochondrial;1.15.1.1;SOD2; SOD2 GClnc1, IPO-B, IPOB, MNSOD, MVCD6, Mn-SOD superoxide dismutase 2 superoxide dismutase [Mn], mitochondrial|Mn superoxide dismutase|epididymis secretory sperm binding protein|gastric cancer-associated lncRNA 1|indophenoloxidase B|manganese-containing superoxide dismutase|mangano-superoxide dismutase|superoxide dismutase 2, mitochondrial
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SOD2, check out the SOD2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SOD2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SOD2 Antibody Picoband® (PB9442)
Hello CJ!
PB9442 has been cited in 3 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
The key role of miR-21-regulated SOD2 in the medium-mediated bystander responses in human fibroblasts induced by α-irradiated keratinocytes
Therapeutic effect of SIRT3 on glucocorticoid-induced osteonecrosis of femoral head via intracellular oxidative suppression
Maternal inflammation activated ROS-p38 MAPK predisposes offspring to heart damages caused by isoproterenol via augmenting ROS generation
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SOD2 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-SOD2 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-SOD2 Antibody Picoband®
Question
Here is the WB image, lot number and protocol we used for testis using anti-SOD2 antibody PB9442. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-03-26
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-03-26
Question
I would like to test anti-SOD2 antibody PB9442 on mouse testis for research purposes, then I may be interested in using anti-SOD2 antibody PB9442 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-03-23
Answer
The products we sell, including anti-SOD2 antibody PB9442, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-03-23
Question
Is a blocking peptide available for product anti-SOD2 antibody (PB9442)?
F. Li
Verified customer
Asked: 2020-03-09
Answer
We do provide the blocking peptide for product anti-SOD2 antibody (PB9442). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-03-09
Question
We are currently using anti-SOD2 antibody PB9442 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human, mouse. Is it true that the antibody can work on bovine tissues as well?
Verified Customer
Verified customer
Asked: 2019-12-23
Answer
The anti-SOD2 antibody (PB9442) has not been validated for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-12-23
Question
My team were satisfied with the WB result of your anti-SOD2 antibody. However we have seen positive staining in gastrocnemius mitochondrion matrix. using this antibody. Is that expected? Could you tell me where is SOD2 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-09-02
Answer
From what I have seen in literature, gastrocnemius does express SOD2. Generally SOD2 expresses in mitochondrion matrix. Regarding which tissues have SOD2 expression, here are a few articles citing expression in various tissues:
Colon, Pubmed ID: 1988135, 7702755
Heart, Pubmed ID: 7498159, 7895732
Hippocampus, Testis, Tongue, and Uterus, Pubmed ID: 14702039
Liver, Pubmed ID: 2831093, 24275569
Lung, Pubmed ID: 15489334
Mammary carcinoma, Pubmed ID: 9150946
Boster Scientific Support
Answered: 2019-09-02
Question
Would anti-SOD2 antibody PB9442 work for IHC with testis?
G. Williams
Verified customer
Asked: 2019-07-03
Answer
According to the expression profile of testis, SOD2 is highly expressed in testis. So, it is likely that anti-SOD2 antibody PB9442 will work for IHC with testis.
Boster Scientific Support
Answered: 2019-07-03
Question
I see that the anti-SOD2 antibody PB9442 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-05-14
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-05-14
Question
We have observed staining in mouse heart. Any tips? Is anti-SOD2 antibody supposed to stain heart positively?
Verified Customer
Verified customer
Asked: 2018-12-03
Answer
Based on literature heart does express SOD2. Based on Uniprot.org, SOD2 is expressed in gastrocnemius, liver, colon, hippocampus, testis, tongue uterus, lung, heart, mammary carcinoma, among other tissues. Regarding which tissues have SOD2 expression, here are a few articles citing expression in various tissues:
Colon, Pubmed ID: 1988135, 7702755
Heart, Pubmed ID: 7498159, 7895732
Hippocampus, Testis, Tongue, and Uterus, Pubmed ID: 14702039
Liver, Pubmed ID: 2831093, 24275569
Lung, Pubmed ID: 15489334
Mammary carcinoma, Pubmed ID: 9150946
Boster Scientific Support
Answered: 2018-12-03
Question
Is this PB9442 anti-SOD2 antibody reactive to the isotypes of SOD2?
Verified Customer
Verified customer
Asked: 2018-11-20
Answer
The immunogen of PB9442 anti-SOD2 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2 (192-222aa QYKNVRPDYLKAIWNVINWENVTERYMACKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-11-20
Question
My question regarding product PB9442, anti-SOD2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2018-11-09
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9442 anti-SOD2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-11-09
Question
I would like using your anti-SOD2 antibody for regulation of transcription by rna polymerase ii studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2018-11-02
Answer
I appreciate your inquiry. This PB9442 anti-SOD2 antibody is tested on mouse lung tissue, testis tissue, tissue lysate, cardiac muscle tissue, liver tissue, hepg2 whole cell lysate, mammary cancer tissue. It is guaranteed to work for IHC, ICC, WB in human, mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2018-11-02
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for testis using anti-SOD2 antibody PB9442. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2018-06-11
Answer
I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-06-11
Question
Would PB9442 anti-SOD2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
H. Zhao
Verified customer
Asked: 2018-06-07
Answer
You can see on the product datasheet, PB9442 anti-SOD2 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-06-07
Question
Is there a BSA free version of anti-SOD2 antibody PB9442 available?
Verified Customer
Verified customer
Asked: 2017-10-09
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-SOD2 antibody PB9442 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2017-10-09
Question
I was wanting to use your anti-SOD2 antibody for IHC for mouse testis on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse testis identification?
C. Anderson
Verified customer
Asked: 2015-01-14
Answer
You can see on the product datasheet, PB9442 anti-SOD2 antibody has been validated for IHC, ICC, WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse testis in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2015-01-14
Question
Our lab used your anti-SOD2 antibody for IHC on testis last year. I am using mouse, and I plan to use the antibody for ICC next. I am interested in examining testis as well as lung in our next experiment. Could you please give me some suggestion on which antibody would work the best for ICC?
C. Gonzalez
Verified customer
Asked: 2013-12-04
Answer
I have checked the website and datasheets of our anti-SOD2 antibody and I see that PB9442 has been validated on mouse in both IHC and ICC. Thus PB9442 should work for your application. Our Boster satisfaction guarantee will cover this product for ICC in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for ICC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2013-12-04
