Click image to see more details
Product Info Summary
| SKU: | PB9158 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | IF, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-RUNX2 Antibody Picoband®
View all RUNX2/CBFA1 Antibodies
SKU/Catalog Number
PB9158
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-RUNX2 Antibody Picoband® catalog # PB9158. Tested in IF, ICC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-RUNX2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9158)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human RUNX2, identical to the related mouse sequence.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9158 is reactive to RUNX2 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
56 kDa
Calculated molecular weight
56648 MW
Background of RUNX2/CBFA1
Core binding factor A1 (CBFA1/RUNX2) is a runt-like transcription factor essential for osteoblast differentiation. This protein is a member of the RUNX family of transcription factors and has a Runt DNA-binding domain. It is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. RUNX2 plays a non-redundant role for Cbfa1 in tooth development that may be distinct from that in bone formation. In odontogenesis, RUNX2 is not involved in the early signaling networks regulating tooth initiation and early morphogenesis but regulates key epithelial-mesenchymal interactions that control advancing morphogenesis and histodifferentiation of the epithelial enamel organ.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9158 is guaranteed for IF, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Immunocytochemistry/Immunofluorescence, 5μg/ml, Human
Positive Control
WB: human Hela whole cell, human A431 whole cell, human K562 whole cell, human Jurkat whole cell
ICC/IF: A431 cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of RUNX2 using anti-RUNX2 antibody (PB9158).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: recombinant human RUNX2 protein 0.5 ng.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-RUNX2 antigen affinity purified polyclonal antibody (Catalog # PB9158) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for RUNX2 at approximately 50 kDa. The expected band size for RUNX2 is at 50 kDa.
Click image to see more details
Figure 2. Western blot analysis of RUNX2 using anti-RUNX2 antibody (PB9158).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human A431 whole cell lysates,
Lane 3: human K562 whole cell lysates,
Lane 4: human Jurkat whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-RUNX2 antigen affinity purified polyclonal antibody (Catalog # PB9158) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for RUNX2 at approximately 56 kDa. The expected band size for RUNX2 is at 57 kDa.
Click image to see more details
Figure 3. IF analysis of RUNX2 using anti-RUNX2 antibody (PB9158).
RUNX2 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL rabbit anti-RUNX2 Antibody (PB9158) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Protein Target Info & Infographic
Gene/Protein Information For RUNX2 (Source: Uniprot.org, NCBI)
Gene Name
RUNX2
Full Name
Runt-related transcription factor 2
Weight
56648 MW
Alternative Names
Runt-related transcription factor 2;Acute myeloid leukemia 3 protein;Core-binding factor subunit alpha-1;CBF-alpha-1;Oncogene AML-3;Osteoblast-specific transcription factor 2;OSF-2;Polyomavirus enhancer-binding protein 2 alpha A subunit;PEA2-alpha A;PEBP2-alpha A;SL3-3 enhancer factor 1 alpha A subunit;SL3/AKV core-binding factor alpha A subunit;RUNX2;AML3, CBFA1, OSF2, PEBP2A; RUNX2 AML3, CBF-alpha-1, CBFA1, CCD, CCD1, CLCD, OSF-2, OSF2, PEA2aA, PEBP2aA RUNX family transcription factor 2 runt-related transcription factor 2|PEA2-alpha A|PEBP2-alpha A|SL3-3 enhancer factor 1 alpha A subunit|SL3/AKV core-binding factor alpha A subunit|acute myeloid leukemia 3 protein|core-binding factor, runt domain, alpha subunit 1|oncogene AML-3|osteoblast-specific transcription factor 2|polyomavirus enhancer-binding protein 2 alpha A subunit|runt related transcription factor 2
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on RUNX2, check out the RUNX2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for RUNX2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-RUNX2 Antibody Picoband® (PB9158)
Hello CJ!
PB9158 has been cited in 11 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Chen G,Wang Q,Li Z,Yang Q,Liu Y,Du Z,Zhang G,Song Y.Circular RNA CDR1as promotes adipogenic and suppresses osteogenic differentiation of BMSCs in steroid-induced osteonecrosis of the femoral head.Bone.2020 Apr;133:115258.doi:10.1016/j.bone.2020.115258.Epu
Species: Human
PB9158 usage in article: APP:WB, SAMPLE:BMSCS, DILUTION:NA
Effects of Intermittent Administration of Parathyroid Hormone (1-34) on Bone Differentiation in Stromal Precursor Antigen-1 Positive Human Periodontal Ligament Stem Cells
Yao S, Zhao W, Ou Q, Liang L, Lin X, Wang Y. Stem Cells Int. 2017;2017:3028647. doi: 10.1155/2017/3028647. Epub 2017 Oct 29. MicroRNA-214 Suppresses Osteogenic Differentiation of Human Periodontal Ligament Stem Cells by Targeting ATF4
Liu Q, Ma Y, Wang J, Zhu X, Yang Y, Mei Y. PLoS One. 2017 Mar 2;12(3):e0172693. doi: 10.1371/journal.pone.0172693. eCollection 2017. Demineralized bone matrix used for direct pulp capping in rats
Liu F, Zhong H, Liang Jy, Fu P, Luo Zj, Zhou L, Gou R, Huang J. J Zhejiang Univ Sci B. 2010 Dec;11(12):905-11. Doi: 10.1631/Jzus.B1000119. Effect Of High Glucose Levels On The Calcification Of Vascular Smooth Muscle Cells By Inducing Osteoblastic ...
Shan T, Zhou C, Yang R, Yan F, Zhang P, Fu Y, Jiang H. Cell Biol Int. 2015 Jan;39(1):35-43. Doi: 10.1002/Cbin.10340. Epub 2014 Jul 28. Lithium Chloride Promotes The Odontoblast Differentiation Of Hair Follicle Neural Crest Cells By Activating Wnt/...
Wang S, Mu J, Fan Z, Yu Y, Yan M, Lei G, Tang C, Wang Z, Zheng Y, Yu J, Zhang G. Stem Cell Res. 2012 May;8(3):346-56. Doi: 10.1016/J.Scr.2011.12.005. Epub 2011 Dec 21. Insulin-Like Growth Factor 1 Can Promote The Osteogenic Differentiation And Ost...
Mu C, Lv T, Wang Z, Ma S, Ma J, Liu J, Yu J, Mu J. Biomed Res Int. 2014;2014:494378. Doi: 10.1155/2014/494378. Epub 2014 Apr 15. Mechanical Stress Stimulates The Osteo/Odontoblastic Differentiation Of Human Stem Cells From Apical Papilla Via Erk 1...
Xue P, Wu X, Zhou L, Ma H, Wang Y, Liu Y, Ma J, Li Y. Biochem Biophys Res Commun. 2013 Apr 5;433(2):226-31. Doi: 10.1016/J.Bbrc.2013.02.088. Epub 2013 Mar 5. Igf1 Promotes Osteogenic Differentiation Of Mesenchymal Stem Cells Derived From Rat Bone ...
Song My, Yu Jz, Zhao Dm, Wei S, Liu Y, Hu Ym, Zhao Wc, Yang Y, Wu H. Cell Biochem Biophys. 2014 May;69(1):47-54. Doi: 10.1007/S12013-013-9764-8. The Time-Dependent Manner Of Sinusoidal Electromagnetic Fields On Rat Bone Marrow Mesenchymal Stem Cel...
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-RUNX2 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-RUNX2 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-RUNX2 Antibody Picoband®
Question
Is there a BSA free version of anti-RUNX2 antibody PB9158 available?
Verified Customer
Verified customer
Asked: 2020-04-28
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-RUNX2 antibody PB9158 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-04-28
Question
Would PB9158 anti-RUNX2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-12-04
Answer
You can see on the product datasheet, PB9158 anti-RUNX2 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-12-04
Question
We have been able to see staining in human cervix carcinoma. Any tips? Is anti-RUNX2 antibody supposed to stain cervix carcinoma positively?
Verified Customer
Verified customer
Asked: 2019-04-17
Answer
From what I have seen in literature cervix carcinoma does express RUNX2. From what I have seen in Uniprot.org, RUNX2 is expressed in tibia, osteoblast, cervix carcinoma, among other tissues. Regarding which tissues have RUNX2 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18220336
Osteoblast, Pubmed ID: 12145306
Boster Scientific Support
Answered: 2019-04-17
Question
Would anti-RUNX2 antibody PB9158 work for WB with osteoblast?
Verified Customer
Verified customer
Asked: 2018-11-23
Answer
According to the expression profile of osteoblast, RUNX2 is highly expressed in osteoblast. So, it is likely that anti-RUNX2 antibody PB9158 will work for WB with osteoblast.
Boster Scientific Support
Answered: 2018-11-23
Question
Please see the WB image, lot number and protocol we used for osteoblast using anti-RUNX2 antibody PB9158. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-10-23
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-10-23
Question
I see that the anti-RUNX2 antibody PB9158 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-10-22
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-10-22
Question
I have a question about product PB9158, anti-RUNX2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
H. Jones
Verified customer
Asked: 2018-05-29
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9158 anti-RUNX2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2018-05-29
Question
Is this PB9158 anti-RUNX2 antibody reactive to the isotypes of RUNX2?
Verified Customer
Verified customer
Asked: 2018-04-30
Answer
The immunogen of PB9158 anti-RUNX2 antibody is A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-04-30
Question
We need to test anti-RUNX2 antibody PB9158 on human osteoblast for research purposes, then I may be interested in using anti-RUNX2 antibody PB9158 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2018-04-06
Answer
The products we sell, including anti-RUNX2 antibody PB9158, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-04-06
Question
Is a blocking peptide available for product anti-RUNX2 antibody (PB9158)?
Verified Customer
Verified customer
Asked: 2018-03-22
Answer
We do provide the blocking peptide for product anti-RUNX2 antibody (PB9158). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-03-22
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for osteoblast using anti-RUNX2 antibody PB9158. Let me know if you need anything else.
K. Lewis
Verified customer
Asked: 2017-10-04
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2017-10-04
Question
I was wanting to use your anti-RUNX2 antibody for WB for human osteoblast on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human osteoblast identification?
V. Miller
Verified customer
Asked: 2017-10-03
Answer
You can see on the product datasheet, PB9158 anti-RUNX2 antibody has been validated for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human osteoblast in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-10-03
Question
We are currently using anti-RUNX2 antibody PB9158 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2017-09-20
Answer
The anti-RUNX2 antibody (PB9158) has not been tested for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-09-20
Question
Our lab want to know about using your anti-RUNX2 antibody for runx2 regulates genes involved in cell migration studies. Has this antibody been tested with western blotting on hela whole cell lysate? We would like to see some validation images before ordering.
J. Edwards
Verified customer
Asked: 2016-05-27
Answer
We appreciate your inquiry. This PB9158 anti-RUNX2 antibody is tested on hela whole cell lysate, a431 whole cell lysate, k562 whole cell lysate, jurkat whole cell lysate. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2016-05-27
Question
We were well pleased with the WB result of your anti-RUNX2 antibody. However we have seen positive staining in tibia nucleus using this antibody. Is that expected? Could you tell me where is RUNX2 supposed to be expressed?
L. Moore
Verified customer
Asked: 2014-07-29
Answer
From what I have seen in literature, tibia does express RUNX2. Generally RUNX2 expresses in nucleus. Regarding which tissues have RUNX2 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18220336
Osteoblast, Pubmed ID: 12145306
Boster Scientific Support
Answered: 2014-07-29
