Product Info Summary
SKU: | PB9875 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-nmt55/p54nrb/NONO Antibody Picoband®
SKU/Catalog Number
PB9875
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-nmt55/p54nrb/NONO Antibody Picoband® catalog # PB9875. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-nmt55/p54nrb/NONO Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9875)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9875 is reactive to NONO in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
60 kDa
Calculated molecular weight
54232 MW
Background of NONO
Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9875 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Positive Control
WB: human Hela whole cell, human A549 whole cell, human SW620 whole cell, human PANC-1 whole cell, human U20S whole cell, rat lung tissue, mouse lung tissue
IHC: mouse brain tissue, human lung cancer tissue, human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue, rat intestine tissue
ICC/IF: U20S cell, SKOV-3 cell
IF: human colon cancer tissue
FCM: HELA cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody (PB9875).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human A549 whole cell lysates,
Lane 3: human SW620 whole cell lysates,
Lane 4: human PANC-1 whole cell lysates,
Lane 5: human U20S whole cell lysates,
Lane 6: rat lung tissue lysates,
Lane 7: mouse lung tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-nmt55/p54nrb antigen affinity purified polyclonal antibody (Catalog # PB9875) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for nmt55/p54nrb at approximately 60KD. The expected band size for nmt55/p54nrb is at 60KD.
Click image to see more details
Figure 2. IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody (PB9875).
nmt55/p54nrb was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-nmt55/p54nrb Antibody (PB9875) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody (PB9875).
nmt55/p54nrb was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-nmt55/p54nrb Antibody (PB9875) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody (PB9875).
nmt55/p54nrb was detected in paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-nmt55/p54nrb Antibody (PB9875) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody (PB9875).
nmt55/p54nrb was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-nmt55/p54nrb Antibody (PB9875) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 6. IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody (PB9875).
nmt55/p54nrb was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-nmt55/p54nrb Antibody (PB9875) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 7. IHC analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody (PB9875).
nmt55/p54nrb was detected in paraffin-embedded section of rat intestine tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-nmt55/p54nrb Antibody (PB9875) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 8. IF analysis of nmt55/p54nrbusing anti-nmt55/p54nrb antibody (PB9875).
nmt55/p54nrb was detected in paraffin-embedded section of human colon cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/mL rabbit anti-nmt55/p54nrb Antibody (PB9875) overnight at 4°C. Biotin conjugated goat anti-rabbit IgG (BA1003) was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using DyLight®594 Conjugated Avidin (BA1142). The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 9. IF analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody (PB9875).
nmt55/p54nrb was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-nmt55/p54nrb Antibody (PB9875) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 10. IF analysis of nmt55/p54nrb using anti-nmt55/p54nrb antibody (PB9875).
nmt55/p54nrb was detected in immunocytochemical section of SKOV-3 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-nmt55/p54nrb Antibody (PB9875) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 11. Flow Cytometry analysis of HELA cells using anti-nmt55/p54nrb antibody (PB9875).
Overlay histogram showing HELA cells stained with PB9875 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-nmt55/p54nrb Antibody (PB9875, 1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Protein Target Info & Infographic
Gene/Protein Information For NONO (Source: Uniprot.org, NCBI)
Gene Name
NONO
Full Name
Non-POU domain-containing octamer-binding protein
Weight
54232 MW
Alternative Names
Non-POU domain-containing octamer-binding protein;NonO protein;54 kDa nuclear RNA- and DNA-binding protein;55 kDa nuclear protein;DNA-binding p52/p100 complex, 52 kDa subunit;NMT55;p54 (nrb);p54nrb;NONO;NRB54; NONO MRXS34, NMT55, NRB54, P54, P54NRB, PPP1R114 non-POU domain containing octamer binding non-POU domain-containing octamer-binding protein|54 kDa nuclear RNA- and DNA-binding protein|55 kDa nuclear protein|DNA-binding p52/p100 complex, 52 kDa subunit|non-POU domain-containing octamer (ATGCAAAT) binding protein|p54(nrb)|protein phosphatase 1, regulatory subunit 114
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on NONO, check out the NONO Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NONO: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-nmt55/p54nrb/NONO Antibody Picoband® (PB9875)
Hello CJ!
No publications found for PB9875
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-nmt55/p54nrb/NONO Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-nmt55/p54nrb/NONO Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-nmt55/p54nrb/NONO Antibody Picoband®
Question
We are currently using anti-nmt55/p54nrb/NONO antibody PB9875 for mouse tissue, and we are content with the Flow Cytometry results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2020-03-04
Answer
The anti-nmt55/p54nrb/NONO antibody (PB9875) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-03-04
Question
Does anti-nmt55/p54nrb/NONO antibody PB9875 work for WB with cervix carcinoma erythroleukemia?
Verified Customer
Verified customer
Asked: 2019-12-23
Answer
According to the expression profile of cervix carcinoma erythroleukemia, NONO is highly expressed in cervix carcinoma erythroleukemia. So, it is likely that anti-nmt55/p54nrb/NONO antibody PB9875 will work for WB with cervix carcinoma erythroleukemia.
Boster Scientific Support
Answered: 2019-12-23
Question
Is this PB9875 anti-nmt55/p54nrb/NONO antibody reactive to the isotypes of NONO?
Verified Customer
Verified customer
Asked: 2019-11-28
Answer
The immunogen of PB9875 anti-nmt55/p54nrb/NONO antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-11-28
Question
I was wanting to use your anti-nmt55/p54nrb/NONO antibody for WB for human cervix carcinoma erythroleukemia on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human cervix carcinoma erythroleukemia identification?
L. Dhar
Verified customer
Asked: 2016-06-07
Answer
You can see on the product datasheet, PB9875 anti-nmt55/p54nrb/NONO antibody has been tested for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human cervix carcinoma erythroleukemia in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2016-06-07
Question
Is a blocking peptide available for product anti-nmt55/p54nrb/NONO antibody (PB9875)?
J. Jha
Verified customer
Asked: 2015-08-19
Answer
We do provide the blocking peptide for product anti-nmt55/p54nrb/NONO antibody (PB9875). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2015-08-19
Question
Can you help my question with product PB9875, anti-nmt55/p54nrb/NONO antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
S. Wu
Verified customer
Asked: 2015-04-21
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9875 anti-nmt55/p54nrb/NONO antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2015-04-21