Anti-NFIB/NF1B2 Antibody Picoband®

NFIB antibody

Boster Bio Anti-NFIB/NF1B2 Antibody Picoband® catalog # A01537-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A01537-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-NFIB/NF1B2 Antibody Picoband®

View all NFIB Antibodies

SKU/Catalog Number

A01537-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-NFIB/NF1B2 Antibody Picoband® catalog # A01537-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-NFIB/NF1B2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01537-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human NFIB/NF1B2, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A01537-1 is reactive to NFIB in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

50 kDa

Calculated molecular weight

47.442kDa

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A01537-1 is guaranteed for IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Positive Control

WB: human Hela whole cell, rat PC-12 whole cell, mouse lung tissue, mouse ovary tissue, mouse HEPA1-6 whole cell
IHC: human mammary cancer tissue, mouse lung tissue, rat cardiac muscle tissue

Validation Images & Assay Conditions

Gene/Protein Information For NFIB (Source: Uniprot.org, NCBI)

Gene Name

NFIB

Full Name

Nuclear factor 1 B-type

Weight

47.442kDa

Superfamily

CTF/NF-I family

Alternative Names

Nuclear factor 1 B-type; NF1-B; Nuclear factor 1/B; CCAAT-box-binding transcription factor; CTF; Nuclear factor I/B; NF-I/B; NFI-B; TGGCA-binding protein; NFIB NFIB CTF, HMGIC/NFIB, MACID, NF-I/B, NF1-B, NFI-B, NFI-RED2, NFIB3, NFIB nuclear factor I B nuclear factor 1 B-type|CCAAT-box-binding transcription factor|TGGCA-binding protein|nuclear factor 1/B

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on NFIB, check out the NFIB Infographic

NFIB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NFIB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A01537-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-NFIB/NF1B2 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-NFIB/NF1B2 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-NFIB/NF1B2 Antibody Picoband®

Question

Is this A01537-1 anti-NFIB/NF1B2 antibody reactive to the isotypes of NFIB?

Verified Customer

Verified customer

Asked: 2020-05-01

Answer

The immunogen of A01537-1 anti-NFIB/NF1B2 antibody is A synthetic peptide corresponding to a sequence of human NFIB/NF1B2 (ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-05-01

Question

We are interested in to test anti-NFIB/NF1B2 antibody A01537-1 on rat foreskin for research purposes, then I may be interested in using anti-NFIB/NF1B2 antibody A01537-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-03-03

Answer

The products we sell, including anti-NFIB/NF1B2 antibody A01537-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-03-03

Question

Do you have a BSA free version of anti-NFIB/NF1B2 antibody A01537-1 available?

Verified Customer

Verified customer

Asked: 2020-02-12

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-NFIB/NF1B2 antibody A01537-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-02-12

Question

My question regarding product A01537-1, anti-NFIB/NF1B2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-01-20

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01537-1 anti-NFIB/NF1B2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-01-20

Question

Is a blocking peptide available for product anti-NFIB/NF1B2 antibody (A01537-1)?

Verified Customer

Verified customer

Asked: 2019-06-28

Answer

We do provide the blocking peptide for product anti-NFIB/NF1B2 antibody (A01537-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-06-28

Question

We are currently using anti-NFIB/NF1B2 antibody A01537-1 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2017-05-22

Answer

The anti-NFIB/NF1B2 antibody (A01537-1) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-05-22

Order DetailsPrice
A01537-1

100μg

$370
A01537-1-10ug

10μg sample (liquid)

$99
A01537-1-Biotin

100 μg Biotin conjugated

$570
A01537-1-Cy3

100 μg Cy3 conjugated

$570
A01537-1-Dylight488

100 μg Dylight488 conjugated

$570
A01537-1-Dylight550

100 μg Dylight550 conjugated

$570
A01537-1-Dylight594

100 μg Dylight594 conjugated

$570
A01537-1-FITC

100 μg FITC conjugated

$570
A01537-1-HRP

100 μg HRP conjugated

$570
A01537-1-APC

100 μg APC conjugated

$670
A01537-1-PE

100 μg PE conjugated

$670
A01537-1-iFluor647

100 μg iFluor647 conjugated

$670
A01537-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01537-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.