p38 (MAPK14) (NM_139012) Human Recombinant Protein

p38 alpha protein,

Product Info Summary

SKU: PROTQ16539
Size: 20 µg
Source: HEK293T

Product Name

p38 (MAPK14) (NM_139012) Human Recombinant Protein

View all p38 alpha recombinant proteins

SKU/Catalog Number

PROTQ16539

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

p38 (MAPK14) (NM_139012) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16539)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41.1 kDa

Amino Acid Sequence

MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Validation Images & Assay Conditions

Gene/Protein Information For MAPK14 (Source: Uniprot.org, NCBI)

Gene Name

MAPK14

Full Name

Mitogen-activated protein kinase 14

Weight

41.1 kDa

Superfamily

protein kinase superfamily

Alternative Names

MAPK14; p38 alpha; SAPK2a MAPK14 CSBP, CSBP1, CSBP2, CSPB1, EXIP, Mxi2, PRKM14, PRKM15, RK, SAPK2A, p38, p38ALPHA mitogen-activated protein kinase 14 mitogen-activated protein kinase 14|CSAID-binding protein|MAP kinase 14|MAP kinase Mxi2|MAP kinase p38 alpha|MAX-interacting protein 2|cytokine suppressive anti-inflammatory drug binding protein|mitogen-activated protein kinase p38 alpha|p38 MAP kinase|p38 mitogen activated protein kinase|p38alpha Exip|stress-activated protein kinase 2A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MAPK14, check out the MAPK14 Infographic

MAPK14 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MAPK14: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16539

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used p38 (MAPK14) (NM_139012) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For p38 (MAPK14) (NM_139012) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for p38 (MAPK14) (NM_139012) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16539
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.