Anti-Integrin alpha2 ITGA2 Antibody

Integrin alpha 2/CD49b antibody

Boster Bio Anti-Integrin alpha2 ITGA2 Antibody catalog # A01933. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A01933
Size: 100μl
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Integrin alpha2 ITGA2 Antibody

View all Integrin alpha 2/CD49b Antibodies

SKU/Catalog Number

A01933

Size

100μl

Form

Liquid

Description

Boster Bio Anti-Integrin alpha2 ITGA2 Antibody catalog # A01933. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Integrin alpha2 ITGA2 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01933)

Host

Rabbit

Contents

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.

Clonality

Polyclonal

Isotype

IgG

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse Synthetic peptide NSSAPGKPKTGKKSKQQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAF

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross reactivity with other proteins.

Reactive Species

A01933 is reactive to ITGA2 in Human, Mouse, Rat

Applications

A01933 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

39 kDa

Calculated molecular weight

129295 MW

Background of Integrin alpha 2/CD49b

CaM Kinase IV (also known as CAM kinase-GR and CaMK IV) is a calcium/ calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. This kinase may be involved in the transcriptional regulation of microtubule dynamics. In vitro, CaMK IV phosphorylates CREB1, CREBBP, PRM2, MEF2A, MEF2D and STMN1/OP18. CaMK IV may also be involved in spermatogenesis and may play a role in the consolidation/ retention of hippocampus-dependent long-term memory. CaMK IV must be phosphorylated to be maximally active and is phosphorylated by CAMKK1 or CAMKK2. In addition autophosphorylation of the N-terminus is required for full activation. Autophosphorylation of Ser-336 allows the kinase to switch to a Ca(2+)/calmodulin-independent state. Most likely the kinase is inactivated by the serine/ threonine protein phosphatase 2A. CaMK IV is a monomer that is located within the cytoplasm and nucleus and substantial localization occurs in certain neuronal nuclei. In spermatids CaMK IV is associated with chromatin and the nuclear matrix. CaMK IV is also specifically expressed in epithelial ovarian cancer tissue.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Restore with deionized water (or equivalent) for reconstitution volume of 100 µL

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

WB, 1:500-1:2000
IHC-P, 1:100-1:300

Validation Images & Assay Conditions

Gene/Protein Information For ITGA2 (Source: Uniprot.org, NCBI)

Gene Name

ITGA2

Full Name

Integrin alpha-2

Weight

129295 MW

Superfamily

integrin alpha chain family

Alternative Names

alpha-2 subunit; CD49b antigen; CD49b; Integrin alpha 2; integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor); ITGA2; VLA 2; VLA-2 alpha ITGA2 BR, CD49B, GPIa, HPA-5, VLA-2, VLAA2 integrin subunit alpha 2 integrin alpha-2|CD49 antigen-like family member B|alpha 2 subunit of VLA-2 receptor|collagen receptor|human platelet alloantigen system 5|integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)|platelet antigen Br|platelet glycoprotein GPIa|platelet membrane glycoprotein Ia|very late activation protein 2 receptor, alpha-2 subunit

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ITGA2, check out the ITGA2 Infographic

ITGA2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ITGA2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A01933

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Integrin alpha2 ITGA2 Antibody?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Integrin alpha2 ITGA2 Antibody

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-Integrin alpha2 ITGA2 Antibody

Order DetailsPrice
A01933

100uL

$399

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01933
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$399.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.