Product Info Summary
SKU: | A00480-Dyl550 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | Flow Cytometry |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Human CD5 DyLight® 550 conjugated Antibody
SKU/Catalog Number
A00480-Dyl550
Size
100 μg/vial
Form
Liquid
Description
Boster Bio Anti-Human CD5 DyLight® 550 conjugated Antibody catalog # A00480-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.
Storage & Handling
At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
Cite This Product
Anti-Human CD5 DyLight® 550 conjugated Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00480-Dyl550)
Host
Rabbit
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CD5, which shares 92.1% and 89.5% amino acid (aa) sequence identity with mouse and rat CD5, respectively.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00480-Dyl550 is reactive to CD5 in Human
Reconstitution
Observed Molecular Weight
39 kDa
Calculated molecular weight
Background of CD5
CD5 is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. In humans, the gene is located on the long arm of chromosome 11. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00480-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Positive Control
Validation Images & Assay Conditions
![boster box boster box](https://www.bosterbio.com/media/catalog/product/b/o/boster-box.png)
Click image to see more details
Boster Kit Box
Protein Target Info & Infographic
Gene/Protein Information For CD5 (Source: Uniprot.org, NCBI)
Gene Name
CD5
Full Name
T-cell surface glycoprotein CD5
Weight
Alternative Names
CD5 antigen (p56-62); CD5 antigen; CD5 molecule; CD5; LEU1T-cell surface glycoprotein CD5; Lymphocyte antigen T1/Leu-1; T1 CD5 LEU1, T1 CD5 molecule T-cell surface glycoprotein CD5|CD5 antigen (p56-62)|epididymis secretory sperm binding protein|lymphocyte antigen T1/Leu-1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CD5, check out the CD5 Infographic
![CD5 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CD5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Human CD5 DyLight® 550 conjugated Antibody (A00480-Dyl550)
Hello CJ!
No publications found for A00480-Dyl550
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Human CD5 DyLight® 550 conjugated Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Human CD5 DyLight® 550 conjugated Antibody
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
14 Customer Q&As for Anti-Human CD5 DyLight® 550 conjugated Antibody
Question
I see that the anti-Human CD5 DyLight® 550 conjugated antibody A00480-Dyl550 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2020-04-14
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-04-14
Question
We have observed staining in human lymphocyte. What should we do? Is anti-Human CD5 DyLight® 550 conjugated antibody supposed to stain lymphocyte positively?
E. Anderson
Verified customer
Asked: 2020-04-08
Answer
According to literature lymphocyte does express CD5. According to Uniprot.org, CD5 is expressed in leukocyte, lymphocyte, thymus, pancreas, leukemic t-cell, among other tissues. Regarding which tissues have CD5 expression, here are a few articles citing expression in various tissues:
Leukemic T-cell, Pubmed ID: 15144186, 19690332
Lymphocyte, Pubmed ID: 8740779
Pancreas, Pubmed ID: 15489334
Thymus, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2020-04-08
Question
Will A00480-Dyl550 anti-Human CD5 DyLight® 550 conjugated antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-01-27
Answer
As indicated on the product datasheet, A00480-Dyl550 anti-Human CD5 DyLight® 550 conjugated antibody as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-01-27
Question
I have a question about product A00480-Dyl550, anti-Human CD5 DyLight® 550 conjugated antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-09-16
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00480-Dyl550 anti-Human CD5 DyLight® 550 conjugated antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-09-16
Question
I was wanting to use your anti-Human CD5 DyLight® 550 conjugated antibody for Flow Cytometry for human leukemic t-cell on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human leukemic t-cell identification?
Verified Customer
Verified customer
Asked: 2019-08-06
Answer
As indicated on the product datasheet, A00480-Dyl550 anti-Human CD5 DyLight® 550 conjugated antibody has been tested for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human leukemic t-cell in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-08-06
Question
We are currently using anti-Human CD5 DyLight® 550 conjugated antibody A00480-Dyl550 for human tissue, and we are satisfied with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on horse tissues as well?
Verified Customer
Verified customer
Asked: 2019-06-24
Answer
The anti-Human CD5 DyLight® 550 conjugated antibody (A00480-Dyl550) has not been tested for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-06-24
Question
Is there a BSA free version of anti-Human CD5 DyLight® 550 conjugated antibody A00480-Dyl550 available?
Verified Customer
Verified customer
Asked: 2019-05-13
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Human CD5 DyLight® 550 conjugated antibody A00480-Dyl550 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-05-13
Question
Here is the WB image, lot number and protocol we used for leukemic t-cell using anti-Human CD5 DyLight® 550 conjugated antibody A00480-Dyl550. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-08-16
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-08-16
Question
Is this A00480-Dyl550 anti-Human CD5 DyLight® 550 conjugated antibody reactive to the isotypes of CD5?
Verified Customer
Verified customer
Asked: 2018-05-08
Answer
The immunogen of A00480-Dyl550 anti-Human CD5 DyLight® 550 conjugated antibody is A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-05-08
Question
Is a blocking peptide available for product anti-Human CD5 DyLight® 550 conjugated antibody (A00480-Dyl550)?
T. Collins
Verified customer
Asked: 2018-01-18
Answer
We do provide the blocking peptide for product anti-Human CD5 DyLight® 550 conjugated antibody (A00480-Dyl550). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-01-18
Question
My team were satisfied with the WB result of your anti-Human CD5 DyLight® 550 conjugated antibody. However we have been able to see positive staining in leukocyte cell membrane using this antibody. Is that expected? Could you tell me where is CD5 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2017-10-12
Answer
From what I have seen in literature, leukocyte does express CD5. Generally CD5 expresses in cell membrane. Regarding which tissues have CD5 expression, here are a few articles citing expression in various tissues:
Leukemic T-cell, Pubmed ID: 15144186, 19690332
Lymphocyte, Pubmed ID: 8740779
Pancreas, Pubmed ID: 15489334
Thymus, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2017-10-12
Question
Will anti-Human CD5 DyLight® 550 conjugated antibody A00480-Dyl550 work for Flow Cytometry with leukemic t-cell?
M. Brown
Verified customer
Asked: 2016-12-05
Answer
According to the expression profile of leukemic t-cell, CD5 is highly expressed in leukemic t-cell. So, it is likely that anti-Human CD5 DyLight® 550 conjugated antibody A00480-Dyl550 will work for Flow Cytometry with leukemic t-cell.
Boster Scientific Support
Answered: 2016-12-05
Question
I would like to test anti-Human CD5 DyLight® 550 conjugated antibody A00480-Dyl550 on human leukemic t-cell for research purposes, then I may be interested in using anti-Human CD5 DyLight® 550 conjugated antibody A00480-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
M. Parker
Verified customer
Asked: 2015-03-10
Answer
The products we sell, including anti-Human CD5 DyLight® 550 conjugated antibody A00480-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2015-03-10
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for leukemic t-cell using anti-Human CD5 DyLight® 550 conjugated antibody A00480-Dyl550. Let me know if you need anything else.
T. Patel
Verified customer
Asked: 2015-01-19
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2015-01-19