Click image to see more details
Product Info Summary
| SKU: | A00040-Dyl550 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | Flow Cytometry |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Human Bcl-2 DyLight® 550 conjugated Antibody
SKU/Catalog Number
A00040-Dyl550
Size
100 μg/vial
Form
Liquid
Description
Boster Bio Anti-Human Bcl-2 DyLight® 550 conjugated Antibody catalog # A00040-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.
Storage & Handling
At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
Cite This Product
Anti-Human Bcl-2 DyLight® 550 conjugated Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00040-Dyl550)
Host
Rabbit
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00040-Dyl550 is reactive to BCL2 in Human
Applications
A00040-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee
Observed Molecular Weight
39 kDa
Calculated molecular weight
Background of Bcl-2
Immunoreactive BCL2 protein in the neoplastic cells of almost all follicular lymphomas whereas no BCL2 protein was detected in follicles affected by nonneoplastic processes or in normal lymphoid tissue. Every tumor with molecular-genetic evidence of t (14;18) translocation expressed detectable levels of BCL2 protein, regardless of whether the breakpoint was located in or at a distance from the BCL2 gene. Overexpression of BCL2 blocks the apoptotic death of a pro-B-lymphocyte cell line.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Boster Kit Box
Protein Target Info & Infographic
Gene/Protein Information For BCL2 (Source: Uniprot.org, NCBI)
Gene Name
BCL2
Full Name
Apoptosis regulator Bcl-2
Weight
Superfamily
Bcl-2 family
Alternative Names
apoptosis regulator Bcl-2; B-cell CLL/lymphoma 2; Bcl2; Bcl-2 BCL2 Bcl-2, PPP1R50 BCL2 apoptosis regulator apoptosis regulator Bcl-2|B-cell CLL/lymphoma 2|protein phosphatase 1, regulatory subunit 50
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on BCL2, check out the BCL2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for BCL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Human Bcl-2 DyLight® 550 conjugated Antibody (A00040-Dyl550)
Hello CJ!
A00040-Dyl550 has been cited in 21 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Oleanolic acid from Prunella Vulgaris L. Induces SPC-A-1 cell line apoptosis via regulation of Bax, Bad and Bcl-2 Expression
Baicalin attenuates alcoholic liver injury through modulation of hepatic oxidative stress, inflammation and sonic hedgehog pathway in rats
Antitumor effects of Laminaria extract fucoxanthin on lung cancer
Recombinant Newcastle disease virus expressing human IFN%u2010%u03BB1 (rL%u2010hIFN%u2010%u03BB1)%u2010induced apoptosis of A549 cells is connected to endoplasmic reticulum stress %u2026
The inhibition effect of triptolide on human endometrial carcinoma cell line HEC-1B: A in vitro and in vivo studies
Ibutilide treatment protects against ER stress induced apoptosis by regulating calumenin expression in tunicamycin treated cardiomyocytes
NOB1 silencing inhibits the growth and metastasis of laryngeal cancer cells through the regulation of JNK signaling pathway
Transforming growth factor-beta1 suppresses hepatocellular carcinoma proliferation via activation of Hippo signaling
Reactive oxygen species-induced apoptosis in PC12 cells and protective effect of bilobalide
Myricetin exhibits anti-glioma potential by inducing mitochondrial-mediated apoptosis, cell cycle arrest, inhibition of cell migration and ROS generation
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Human Bcl-2 DyLight® 550 conjugated Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Human Bcl-2 DyLight® 550 conjugated Antibody
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
14 Customer Q&As for Anti-Human Bcl-2 DyLight® 550 conjugated Antibody
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for thyroid gland using anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2020-03-16
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-03-16
Question
Is there a BSA free version of anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 available?
Verified Customer
Verified customer
Asked: 2020-02-14
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-02-14
Question
Does anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 work for Flow Cytometry with thyroid gland?
Verified Customer
Verified customer
Asked: 2019-12-09
Answer
According to the expression profile of thyroid gland, BCL2 is highly expressed in thyroid gland. So, it is likely that anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 will work for Flow Cytometry with thyroid gland.
Boster Scientific Support
Answered: 2019-12-09
Question
We have seen staining in human testis. What should we do? Is anti-Human Bcl-2 DyLight® 550 conjugated antibody supposed to stain testis positively?
Verified Customer
Verified customer
Asked: 2019-11-29
Answer
From what I have seen in literature testis does express BCL2. From what I have seen in Uniprot.org, BCL2 is expressed in thyroid gland, testis, among other tissues. Regarding which tissues have BCL2 expression, here are a few articles citing expression in various tissues:
Testis, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-11-29
Question
We are currently using anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 for human tissue, and we are happy with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on pig tissues as well?
Verified Customer
Verified customer
Asked: 2019-10-31
Answer
The anti-Human Bcl-2 DyLight® 550 conjugated antibody (A00040-Dyl550) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-10-31
Question
See attached the WB image, lot number and protocol we used for thyroid gland using anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-09-11
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-09-11
Question
My boss were satisfied with the WB result of your anti-Human Bcl-2 DyLight® 550 conjugated antibody. However we have been able to see positive staining in thyroid gland mitochondrion outer membrane using this antibody. Is that expected? Could you tell me where is BCL2 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-08-27
Answer
According to literature, thyroid gland does express BCL2. Generally BCL2 expresses in mitochondrion outer membrane. Regarding which tissues have BCL2 expression, here are a few articles citing expression in various tissues:
Testis, Pubmed ID: 15489334
Boster Scientific Support
Answered: 2019-08-27
Question
I have a question about product A00040-Dyl550, anti-Human Bcl-2 DyLight® 550 conjugated antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-07-10
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00040-Dyl550 anti-Human Bcl-2 DyLight® 550 conjugated antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-07-10
Question
Would A00040-Dyl550 anti-Human Bcl-2 DyLight® 550 conjugated antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
J. Zhao
Verified customer
Asked: 2019-06-10
Answer
As indicated on the product datasheet, A00040-Dyl550 anti-Human Bcl-2 DyLight® 550 conjugated antibody as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-06-10
Question
Our lab want to know about to test anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 on human thyroid gland for research purposes, then I may be interested in using anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-06-10
Answer
The products we sell, including anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-06-10
Question
Is a blocking peptide available for product anti-Human Bcl-2 DyLight® 550 conjugated antibody (A00040-Dyl550)?
K. Anderson
Verified customer
Asked: 2019-05-24
Answer
We do provide the blocking peptide for product anti-Human Bcl-2 DyLight® 550 conjugated antibody (A00040-Dyl550). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-05-24
Question
I see that the anti-Human Bcl-2 DyLight® 550 conjugated antibody A00040-Dyl550 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
M. Zhao
Verified customer
Asked: 2018-09-05
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-09-05
Question
I was wanting to use your anti-Human Bcl-2 DyLight® 550 conjugated antibody for Flow Cytometry for human thyroid gland on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human thyroid gland identification?
Verified Customer
Verified customer
Asked: 2017-06-20
Answer
You can see on the product datasheet, A00040-Dyl550 anti-Human Bcl-2 DyLight® 550 conjugated antibody has been tested for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human thyroid gland in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-06-20
Question
Is this A00040-Dyl550 anti-Human Bcl-2 DyLight® 550 conjugated antibody reactive to the isotypes of BCL2?
R. Moore
Verified customer
Asked: 2014-01-14
Answer
The immunogen of A00040-Dyl550 anti-Human Bcl-2 DyLight® 550 conjugated antibody is A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2014-01-14
