Anti-HOXA5 Antibody Picoband™

HOXA5 antibody

Boster Bio Anti-HOXA5 Antibody Picoband™ catalog # A04018-2. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A04018-2
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-HOXA5 Antibody Picoband™

View all HOXA5 Antibodies

SKU/Catalog Number

A04018-2

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-HOXA5 Antibody Picoband™ catalog # A04018-2. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-HOXA5 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04018-2)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human HOXA5, which shares 100% and 97.6% amino acid (aa) sequence identity with mouse and rat HOXA5, respectively.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A04018-2 is reactive to HOXA5 in Human, Mouse, Rat

Applications

A04018-2 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

29 kDa

Calculated molecular weight

23310 MW

Background of HOXA5

Homeobox protein Hox-A5 is a protein that in humans is encoded the HOXA5 gene. In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For HOXA5 (Source: Uniprot.org, NCBI)

Gene Name

HOXA5

Full Name

Homeobox protein Hox-A5

Weight

23310 MW

Superfamily

Antp homeobox family

Alternative Names

homeo box 1C; homeo box A5; homeobox A5; Homeobox protein Hox-1C; homeobox protein HOXA5; homeobox protein Hox-A5; HOX1; HOX1.3; HOX1CMGC9376 HOXA5 HOX1, HOX1.3, HOX1C homeobox A5 homeobox protein Hox-A5|homeo box 1C|homeo box A5|homeobox protein HOXA5|homeobox protein Hox-1C

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on HOXA5, check out the HOXA5 Infographic

HOXA5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HOXA5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A04018-2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-HOXA5 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-HOXA5 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-HOXA5 Antibody Picoband™

Question

I see that the anti-HOXA5 antibody A04018-2 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-02-20

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-02-20

Question

Is this A04018-2 anti-HOXA5 antibody reactive to the isotypes of HOXA5?

Verified Customer

Verified customer

Asked: 2019-08-21

Answer

The immunogen of A04018-2 anti-HOXA5 antibody is A synthetic peptide corresponding to a sequence of human HOXA5 (AQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-08-21

Question

We are currently using anti-HOXA5 antibody A04018-2 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-08

Answer

The anti-HOXA5 antibody (A04018-2) has not been tested for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-08

Question

Will A04018-2 anti-HOXA5 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2017-05-17

Answer

As indicated on the product datasheet, A04018-2 anti-HOXA5 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-05-17

Order DetailsPrice
A04018-2

100μg

$370
A04018-2-10ug

10μg sample (liquid)

$99
A04018-2-Biotin

100 μg Biotin conjugated

$570
A04018-2-Cy3

100 μg Cy3 conjugated

$570
A04018-2-Dylight488

100 μg Dylight488 conjugated

$570
A04018-2-Dylight550

100 μg Dylight550 conjugated

$570
A04018-2-Dylight594

100 μg Dylight594 conjugated

$570
A04018-2-FITC

100 μg FITC conjugated

$570
A04018-2-HRP

100 μg HRP conjugated

$570
A04018-2-APC

100 μg APC conjugated

$670
A04018-2-PE

100 μg PE conjugated

$670
A04018-2-iFluor647

100 μg iFluor647 conjugated

$670
A04018-2-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A04018-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.