Click image to see more details
Product Info Summary
| SKU: | A04018-2 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-HOXA5 Antibody Picoband®
SKU/Catalog Number
A04018-2
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-HOXA5 Antibody Picoband® catalog # A04018-2. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-HOXA5 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04018-2)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HOXA5, which shares 100% and 97.6% amino acid (aa) sequence identity with mouse and rat HOXA5, respectively.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A04018-2 is reactive to HOXA5 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
29 kDa
Calculated molecular weight
23310 MW
Background of HOXA5
Homeobox protein Hox-A5 is a protein that in humans is encoded the HOXA5 gene. In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A04018-2 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Positive Control
WB: human placenta tissue, human Hela cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of HOXA5 using anti-HOXA5 antibody (A04018-2).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human placenta tissue lysates,
Lane 2: human Hela cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-HOXA5 antigen affinity purified polyclonal antibody (Catalog # A04018-2) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for HOXA5 at approximately 29KD. The expected band size for HOXA5 is at 29KD.
Protein Target Info & Infographic
Gene/Protein Information For HOXA5 (Source: Uniprot.org, NCBI)
Gene Name
HOXA5
Full Name
Homeobox protein Hox-A5
Weight
23310 MW
Superfamily
Antp homeobox family
Alternative Names
Homeobox protein Hox-A5; Homeobox protein Hox-1C; HOXA5; HOX1C HOXA5 HOX1, HOX1.3, HOX1C homeobox A5 homeobox protein Hox-A5|homeo box 1C|homeo box A5|homeobox protein HOXA5|homeobox protein Hox-1C
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on HOXA5, check out the HOXA5 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for HOXA5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-HOXA5 Antibody Picoband® (A04018-2)
Hello CJ!
No publications found for A04018-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-HOXA5 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-HOXA5 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-HOXA5 Antibody Picoband®
Question
I see that the anti-HOXA5 antibody A04018-2 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2020-02-20
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-02-20
Question
Is this A04018-2 anti-HOXA5 antibody reactive to the isotypes of HOXA5?
Verified Customer
Verified customer
Asked: 2019-08-21
Answer
The immunogen of A04018-2 anti-HOXA5 antibody is A synthetic peptide corresponding to a sequence of human HOXA5 (AQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-08-21
Question
We are currently using anti-HOXA5 antibody A04018-2 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on primate tissues as well?
Verified Customer
Verified customer
Asked: 2019-08-08
Answer
The anti-HOXA5 antibody (A04018-2) has not been tested for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-08-08
Question
Will A04018-2 anti-HOXA5 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2017-05-17
Answer
As indicated on the product datasheet, A04018-2 anti-HOXA5 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-05-17
