Product Info Summary
SKU: | A00706 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-TrkA/NTRK1 Antibody Picoband™
SKU/Catalog Number
A00706
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-TrkA/NTRK1 Antibody Picoband™ catalog # A00706. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-TrkA/NTRK1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00706)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TrkA, which shares 90.2% amino acid (aa) sequence identity with both mouse and rat TrkA.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00706 is reactive to NTRK1 in Human, Mouse, Rat
Applications
A00706 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
150 kDa
Calculated molecular weight
42982 MW
Background of TrkA
Neurotrophic tyrosine kinase receptor type 1, also called Trk-A, is a protein that in humans is encoded by the NTRK1 gene. The NTKR1 gene encodes the neurotrophic tyrosine kinase-1 receptor and belongs to a family of nerve growth factor receptors whose ligands include neurotrophins. This gene is mapped to 1q23.1. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, mental retardation and cancer.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot,0.1-0.5μg/ml
Validation Images & Assay Conditions
![A00706 TrkA primary antibodies WB testing 1 A00706 TrkA primary antibodies WB testing 1](https://www.bosterbio.com/media/catalog/product/A/0/A00706-TrkA-primary-antibodies-WB-testing-1.jpg)
Click image to see more details
Figure 1. Western blot analysis of TrkA using anti-TrkA antibody (A00706).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human SGC-7901 whole cell lysates,
Lane 3: human THP-1 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TrkA antigen affinity purified polyclonal antibody (Catalog # A00706) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for TrkA at approximately 150KD. The expected band size for TrkA is at 87KD.
Protein Target Info & Infographic
Gene/Protein Information For NTRK1 (Source: Uniprot.org, NCBI)
Gene Name
NTRK1
Full Name
High affinity nerve growth factor receptor
Weight
42982 MW
Superfamily
protein kinase superfamily
Alternative Names
DKFZp781I14186; EC 2.7.10; EC 2.7.10.1; MTChigh affinity nerve growth factor receptor; Neurotrophic tyrosine kinase receptor type 1; neurotrophic tyrosine kinase, receptor, type 1; NTRK1; NTRK-1; p140-TrkA; TRK1-transforming tyrosine kinase protein; TrkA; Trk-A; TRKAOncogene TRK; TRKTRK1; tyrosine kinase receptor A NTRK1 MTC, TRK, TRK1, TRKA, Trk-A, p140-TrkA neurotrophic receptor tyrosine kinase 1 high affinity nerve growth factor receptor|Oncogene TRK|TRK1-transforming tyrosine kinase protein|gp140trk|neurotrophic tyrosine kinase, receptor, type 1|tropomyosin-related kinase A|tyrosine kinase receptor A
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on NTRK1, check out the NTRK1 Infographic
![NTRK1 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NTRK1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-TrkA/NTRK1 Antibody Picoband™ (A00706)
Hello CJ!
No publications found for A00706
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-TrkA/NTRK1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-TrkA/NTRK1 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-TrkA/NTRK1 Antibody Picoband™
Question
My lab would like using your anti-TrkA/NTRK1 antibody for signalling to p38 via rit and rin studies. Has this antibody been tested with western blotting on hela whole cell lysates? We would like to see some validation images before ordering.
T. Krishna
Verified customer
Asked: 2020-04-01
Answer
We appreciate your inquiry. This A00706 anti-TrkA/NTRK1 antibody is tested on human hela, hela whole cell lysates. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2020-04-01
Question
My lab would like to test anti-TrkA/NTRK1 antibody A00706 on human adenohypophysis for research purposes, then I may be interested in using anti-TrkA/NTRK1 antibody A00706 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-02-17
Answer
The products we sell, including anti-TrkA/NTRK1 antibody A00706, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-02-17
Question
We are currently using anti-TrkA/NTRK1 antibody A00706 for mouse tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on dog tissues as well?
B. Johnson
Verified customer
Asked: 2020-02-05
Answer
The anti-TrkA/NTRK1 antibody (A00706) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-02-05
Question
Please see the WB image, lot number and protocol we used for adenohypophysis using anti-TrkA/NTRK1 antibody A00706. Please let me know if you require anything else.
S. Johnson
Verified customer
Asked: 2020-01-15
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-01-15
Question
Is this A00706 anti-TrkA/NTRK1 antibody reactive to the isotypes of NTRK1?
Verified Customer
Verified customer
Asked: 2020-01-09
Answer
The immunogen of A00706 anti-TrkA/NTRK1 antibody is A synthetic peptide corresponding to a sequence of human TrkA (EVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-01-09
Question
We have observed staining in human colon. Are there any suggestions? Is anti-TrkA/NTRK1 antibody supposed to stain colon positively?
Verified Customer
Verified customer
Asked: 2019-12-03
Answer
From literature colon does express NTRK1. From Uniprot.org, NTRK1 is expressed in adenohypophysis, colon, brain, uterus, peripheral blood, among other tissues. Regarding which tissues have NTRK1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334, 7823156, 9290260
Colon, Pubmed ID: 2927393
Peripheral blood, Pubmed ID: 10861667, 10982191
Uterus, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-12-03
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for adenohypophysis using anti-TrkA/NTRK1 antibody A00706. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-11-25
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-11-25
Question
I have a question about product A00706, anti-TrkA/NTRK1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-10-02
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00706 anti-TrkA/NTRK1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-10-02
Question
Does anti-TrkA/NTRK1 antibody A00706 work for WB with adenohypophysis?
Verified Customer
Verified customer
Asked: 2019-09-16
Answer
According to the expression profile of adenohypophysis, NTRK1 is highly expressed in adenohypophysis. So, it is likely that anti-TrkA/NTRK1 antibody A00706 will work for WB with adenohypophysis.
Boster Scientific Support
Answered: 2019-09-16
Question
I see that the anti-TrkA/NTRK1 antibody A00706 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-03-11
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-03-11
Question
Is there a BSA free version of anti-TrkA/NTRK1 antibody A00706 available?
Verified Customer
Verified customer
Asked: 2018-08-01
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-TrkA/NTRK1 antibody A00706 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-08-01
Question
I was wanting to use your anti-TrkA/NTRK1 antibody for WB for human adenohypophysis on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human adenohypophysis identification?
Verified Customer
Verified customer
Asked: 2018-05-17
Answer
It shows on the product datasheet, A00706 anti-TrkA/NTRK1 antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human adenohypophysis in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-05-17
Question
Is a blocking peptide available for product anti-TrkA/NTRK1 antibody (A00706)?
Verified Customer
Verified customer
Asked: 2018-01-15
Answer
We do provide the blocking peptide for product anti-TrkA/NTRK1 antibody (A00706). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-01-15
Question
Our team were satisfied with the WB result of your anti-TrkA/NTRK1 antibody. However we have been able to see positive staining in uterus cell membrane using this antibody. Is that expected? Could you tell me where is NTRK1 supposed to be expressed?
Z. Baker
Verified customer
Asked: 2013-03-11
Answer
From what I have seen in literature, uterus does express NTRK1. Generally NTRK1 expresses in cell membrane. Regarding which tissues have NTRK1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334, 7823156, 9290260
Colon, Pubmed ID: 2927393
Peripheral blood, Pubmed ID: 10861667, 10982191
Uterus, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2013-03-11
Question
Would A00706 anti-TrkA/NTRK1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
P. Patel
Verified customer
Asked: 2013-02-21
Answer
As indicated on the product datasheet, A00706 anti-TrkA/NTRK1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2013-02-21