Click image to see more details
Product Info Summary
| SKU: | A00249-4 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-C Reactive Protein/CRP Antibody Picoband®
View all C-Reactive Protein/CRP Antibodies
SKU/Catalog Number
A00249-4
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-C Reactive Protein/CRP Antibody Picoband® catalog # A00249-4. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-C Reactive Protein/CRP Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00249-4)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human C Reactive Protein, which shares 68.8% and 53.1% amino acid (aa) sequence identity with mouse and rat C Reactive Protein, respectively.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00249-4 is reactive to CRP in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
25 kDa
Calculated molecular weight
25.039kDa
Background of C-Reactive Protein/CRP
C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities associated with preimmune nonspecific host resistance. CRP shows the strongest association with cardiovascular events. It is detectable on the surface of about 4% of normal peripheral blood lymphocytes. Acute phase reactant CRP is produced in the liver.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00249-4 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
Positive Control
IHC: human liver cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of CRP using anti-CRP antibody (A00249-4).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.
Lane 1: recombinant human CRP protein 10 ng,
Lane 2: recombinant human CRP protein 5 ng.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CRP antigen affinity purified polyclonal antibody (Catalog # A00249-4) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for CRP at approximately 25 kDa.
Click image to see more details
Figure 2. IHC analysis of CRP using anti-CRP antibody (A00249-4).
CRP was detected in a paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-CRP Antibody (A00249-4) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For CRP (Source: Uniprot.org, NCBI)
Gene Name
CRP
Full Name
C-reactive protein
Weight
25.039kDa
Superfamily
pentraxin family
Alternative Names
C-reactive protein; C-reactive protein (1-205); CRP; PTX1 CRP PTX1 C-reactive protein C-reactive protein|C-reactive protein, pentraxin-related|pentraxin 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CRP, check out the CRP Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CRP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-C Reactive Protein/CRP Antibody Picoband® (A00249-4)
Hello CJ!
A00249-4 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Protective effects of potential probiotic Lactobacillus rhamnosus (MTCC-5897) fermented whey on reinforcement of intestinal epithelial barrier function in a colitis-induced murine model
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-C Reactive Protein/CRP Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-C Reactive Protein/CRP Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-C Reactive Protein/CRP Antibody Picoband®
Question
Is a blocking peptide available for product anti-C Reactive Protein/CRP antibody (A00249-4)?
Verified Customer
Verified customer
Asked: 2020-02-21
Answer
We do provide the blocking peptide for product anti-C Reactive Protein/CRP antibody (A00249-4). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-02-21
Question
My team were satisfied with the WB result of your anti-C Reactive Protein/CRP antibody. However we have seen positive staining in right lobe of liver secreted. using this antibody. Is that expected? Could you tell me where is CRP supposed to be expressed?
Verified Customer
Verified customer
Asked: 2020-02-07
Answer
According to literature, right lobe of liver does express CRP. Generally CRP expresses in secreted. Regarding which tissues have CRP expression, here are a few articles citing expression in various tissues:
Liver, Pubmed ID: 15489334
Urinary bladder, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2020-02-07
Question
Is this A00249-4 anti-C Reactive Protein/CRP antibody reactive to the isotypes of CRP?
Verified Customer
Verified customer
Asked: 2019-12-06
Answer
The immunogen of A00249-4 anti-C Reactive Protein/CRP antibody is A synthetic peptide corresponding to a sequence of human C Reactive Protein (QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-12-06
Question
My lab would like to test anti-C Reactive Protein/CRP antibody A00249-4 on mouse liver for research purposes, then I may be interested in using anti-C Reactive Protein/CRP antibody A00249-4 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-07-29
Answer
The products we sell, including anti-C Reactive Protein/CRP antibody A00249-4, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-07-29
Question
I was wanting to use your anti-C Reactive Protein/CRP antibody for WB for mouse liver on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse liver identification?
G. Kulkarni
Verified customer
Asked: 2019-06-03
Answer
As indicated on the product datasheet, A00249-4 anti-C Reactive Protein/CRP antibody has been validated for IHC, WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse liver in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-06-03
Question
Will A00249-4 anti-C Reactive Protein/CRP antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-05-28
Answer
It shows on the product datasheet, A00249-4 anti-C Reactive Protein/CRP antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-05-28
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for liver using anti-C Reactive Protein/CRP antibody A00249-4. Let me know if you need anything else.
B. Krishna
Verified customer
Asked: 2019-05-24
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-05-24
Question
We have observed staining in mouse liver. Are there any suggestions? Is anti-C Reactive Protein/CRP antibody supposed to stain liver positively?
G. Parker
Verified customer
Asked: 2018-03-07
Answer
According to literature liver does express CRP. According to Uniprot.org, CRP is expressed in right lobe of liver, liver, urinary bladder, among other tissues. Regarding which tissues have CRP expression, here are a few articles citing expression in various tissues:
Liver, Pubmed ID: 15489334
Urinary bladder, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2018-03-07
Question
My lab would like using your anti-C Reactive Protein/CRP antibody for defense response to gram-positive bacterium studies. Has this antibody been tested with western blotting on small intestine tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2017-05-15
Answer
Thanks for your inquiry. This A00249-4 anti-C Reactive Protein/CRP antibody is tested on human a431 whole cell lysate, rat liver tissue, liver cancer tissue, mouse liver tissue, small intestine tissue. It is guaranteed to work for IHC, WB in human, mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2017-05-15
Question
Our lab used your anti-C Reactive Protein/CRP antibody for WB on urinary bladder in the past. I am using mouse, and We intend to use the antibody for IHC next. I am interested in examining urinary bladder as well as liver in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC?
E. Mangal
Verified customer
Asked: 2017-02-23
Answer
I looked at the website and datasheets of our anti-C Reactive Protein/CRP antibody and it appears that A00249-4 has been validated on mouse in both WB and IHC. Thus A00249-4 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2017-02-23
Question
Please see the WB image, lot number and protocol we used for liver using anti-C Reactive Protein/CRP antibody A00249-4. Please let me know if you require anything else.
J. Mitchell
Verified customer
Asked: 2016-08-15
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-08-15
Question
We are currently using anti-C Reactive Protein/CRP antibody A00249-4 for mouse tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse. Is it true that the antibody can work on pig tissues as well?
W. Lewis
Verified customer
Asked: 2016-06-06
Answer
The anti-C Reactive Protein/CRP antibody (A00249-4) has not been tested for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2016-06-06
Question
I see that the anti-C Reactive Protein/CRP antibody A00249-4 works with WB, what is the protocol used to produce the result images on the product page?
A. Zhao
Verified customer
Asked: 2016-04-04
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2016-04-04
Question
Would anti-C Reactive Protein/CRP antibody A00249-4 work for WB with liver?
E. Anderson
Verified customer
Asked: 2015-05-28
Answer
According to the expression profile of liver, CRP is highly expressed in liver. So, it is likely that anti-C Reactive Protein/CRP antibody A00249-4 will work for WB with liver.
Boster Scientific Support
Answered: 2015-05-28
Question
Do you have a BSA free version of anti-C Reactive Protein/CRP antibody A00249-4 available?
P. Lewis
Verified customer
Asked: 2014-11-12
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-C Reactive Protein/CRP antibody A00249-4 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2014-11-12
Question
My question regarding product A00249-4, anti-C Reactive Protein/CRP antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
H. Johnson
Verified customer
Asked: 2014-03-21
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00249-4 anti-C Reactive Protein/CRP antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2014-03-21
