XYLB (NM_005108) Human Recombinant Protein

Xylulokinase/XYLB protein,

Recombinant protein of human xylulokinase homolog (H. influenzae) (XYLB)

Product Info Summary

SKU: PROTO75191
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

XYLB (NM_005108) Human Recombinant Protein

View all Xylulokinase/XYLB recombinant proteins

SKU/Catalog Number

PROTO75191

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human xylulokinase homolog (H. influenzae) (XYLB)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

XYLB (NM_005108) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75191)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

58.2 kDa

Amino Acid Sequence

MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTRGPPE

Validation Images & Assay Conditions

Gene/Protein Information For XYLB (Source: Uniprot.org, NCBI)

Gene Name

XYLB

Full Name

Xylulose kinase

Weight

58.2 kDa

Superfamily

FGGY kinase family

Alternative Names

EC 2.7.1.17; FLJ10343; FLJ12539; FLJ22075; XYLB; xylulokinase (H. influenzae) homolog; xylulokinase homolog (H. influenzae); Xylulokinase; Xylulose Kinase XYLB xylulokinase xylulose kinase|D-xylulokinase|xylulokinase homolog (H. influenzae)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on XYLB, check out the XYLB Infographic

XYLB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for XYLB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75191

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used XYLB (NM_005108) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For XYLB (NM_005108) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for XYLB (NM_005108) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75191
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.