Carbonic anhydrase X (CA10) (NM_001082533) Human Recombinant Protein

Carbonic Anhydrase X/CA10 protein,

Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 1

Product Info Summary

SKU: PROTQ9NS85
Size: 20 µg
Source: HEK293T

Product Name

Carbonic anhydrase X (CA10) (NM_001082533) Human Recombinant Protein

View all Carbonic Anhydrase X/CA10 recombinant proteins

SKU/Catalog Number

PROTQ9NS85

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human carbonic anhydrase X (CA10), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Carbonic anhydrase X (CA10) (NM_001082533) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NS85)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37.4 kDa

Amino Acid Sequence

MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK

Validation Images & Assay Conditions

Gene/Protein Information For CA10 (Source: Uniprot.org, NCBI)

Gene Name

CA10

Full Name

Carbonic anhydrase-related protein 10

Weight

37.4 kDa

Superfamily

alpha-carbonic anhydrase family

Alternative Names

CA10; Carbonic Anhydrase X; carbonic anhydrase-related protein 10; Carbonic anhydrase-related protein X; CARP X; CARPX; CA-RPX; CARPXCA-RP X; Cerebral protein 15; cerebral protein-15; HUCEP-15 CA10 CA-RPX, CARPX, HUCEP-15 carbonic anhydrase 10 carbonic anhydrase-related protein 10|CA-RP X|CARP X|carbonic anhydrase X|carbonic anhydrase-related protein X|cerebral protein-15|epididymis secretory sperm binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CA10, check out the CA10 Infographic

CA10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CA10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NS85

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Carbonic anhydrase X (CA10) (NM_001082533) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Carbonic anhydrase X (CA10) (NM_001082533) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Carbonic anhydrase X (CA10) (NM_001082533) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NS85
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.