UBE2L6 (NM_198183) Human Recombinant Protein

UbcH8/Ube2L6 protein,

Product Info Summary

SKU: PROTO14933
Size: 20 µg
Source: HEK293T

Product Name

UBE2L6 (NM_198183) Human Recombinant Protein

View all UbcH8/Ube2L6 recombinant proteins

SKU/Catalog Number

PROTO14933

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin-conjugating enzyme E2L 6 (UBE2L6), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UBE2L6 (NM_198183) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14933)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

9.9 kDa

Amino Acid Sequence

MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS

Validation Images & Assay Conditions

Gene/Protein Information For UBE2L6 (Source: Uniprot.org, NCBI)

Gene Name

UBE2L6

Full Name

Ubiquitin/ISG15-conjugating enzyme E2 L6

Weight

9.9 kDa

Superfamily

ubiquitin-conjugating enzyme family

Alternative Names

EC 6.3.2.19; retinoic acid induced gene B protein; Retinoic acid-induced gene B protein; RIG-B; UbcH8; UBCH8MGC40331; UBE2L6; Ubiquitin carrier protein L6; ubiquitin/ISG15-conjugating enzyme E2 L6; ubiquitin-conjugating enzyme E2L 6; Ubiquitin-protein ligase L6 UBE2L6 RIG-B, UBCH8 ubiquitin conjugating enzyme E2 L6 ubiquitin/ISG15-conjugating enzyme E2 L6|E2 ubiquitin-conjugating enzyme L6|retinoic acid induced gene B protein|ubiquitin carrier protein L6|ubiquitin conjugating enzyme E2L 6|ubiquitin-protein ligase L6

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBE2L6, check out the UBE2L6 Infographic

UBE2L6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBE2L6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO14933

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UBE2L6 (NM_198183) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UBE2L6 (NM_198183) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UBE2L6 (NM_198183) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO14933
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.