UBA52 (NM_003333) Human Recombinant Protein

UBA52 protein,

Recombinant protein of human ubiquitin A-52 residue ribosomal protein fusion product 1 (UBA52), transcript variant 2

Product Info Summary

SKU: PROTP62987
Size: 20 µg
Source: HEK293T

Product Name

UBA52 (NM_003333) Human Recombinant Protein

View all UBA52 recombinant proteins

SKU/Catalog Number

PROTP62987

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ubiquitin A-52 residue ribosomal protein fusion product 1 (UBA52), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

UBA52 (NM_003333) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP62987)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.5 kDa

Amino Acid Sequence

MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK

Validation Images & Assay Conditions

Gene/Protein Information For UBA52 (Source: Uniprot.org, NCBI)

Gene Name

UBA52

Full Name

Ubiquitin-60S ribosomal protein L40

Weight

14.5 kDa

Alternative Names

CEP52ubiquitin carboxyl extension protein 52; HUBCEP52; MGC126879; MGC126881; MGC57125; RPL40; UBCEP2; ubiquitin A-52 residue ribosomal protein fusion product 160S ribosomal protein L40; ubiquitin-52 amino acid fusion protein; ubiquitin-60S ribosomal protein L40; ubiquitin-CEP52 UBA52 CEP52, HUBCEP52, L40, RPL40 ubiquitin A-52 residue ribosomal protein fusion product 1 ubiquitin-60S ribosomal protein L40|ubiquitin carboxyl extension protein 52|ubiquitin-52 amino acid fusion protein|ubiquitin-CEP52

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UBA52, check out the UBA52 Infographic

UBA52 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UBA52: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP62987

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used UBA52 (NM_003333) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For UBA52 (NM_003333) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for UBA52 (NM_003333) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP62987
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.