TSPAN6 (NM_003270) Human Recombinant Protein

TSPAN6 protein,

Recombinant protein of human tetraspanin 6 (TSPAN6)

Product Info Summary

SKU: PROTO43657
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TSPAN6 (NM_003270) Human Recombinant Protein

View all TSPAN6 recombinant proteins

SKU/Catalog Number

PROTO43657

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tetraspanin 6 (TSPAN6)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TSPAN6 (NM_003270) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43657)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.4 kDa

Amino Acid Sequence

MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNNQYEIV

Validation Images & Assay Conditions

Gene/Protein Information For TSPAN6 (Source: Uniprot.org, NCBI)

Gene Name

TSPAN6

Full Name

Tetraspanin-6

Weight

27.4 kDa

Superfamily

tetraspanin (TM4SF) family

Alternative Names

Putative NF-kappa-B-activating protein 321; T245 protein; T245; tetraspanin 6; Tetraspanin TM4-D; tetraspanin-6; TM4-D; TM4SF6; TM4SF6tetraspan TM4SF; Transmembrane 4 superfamily member 6A15 homolog; TSPAN6; TSPAN-6 TSPAN6 T245, TM4SF6, TSPAN-6 tetraspanin 6 tetraspanin-6|A15 homolog|putative NF-kappa-B-activating protein 321|tetraspan TM4SF|tetraspanin TM4-D|transmembrane 4 superfamily member 6

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TSPAN6, check out the TSPAN6 Infographic

TSPAN6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TSPAN6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43657

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TSPAN6 (NM_003270) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TSPAN6 (NM_003270) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TSPAN6 (NM_003270) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43657
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.