trfp (MED20) (NM_004275) Human Recombinant Protein

MED20 protein,

Product Info Summary

SKU: PROTQ9H944
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

trfp (MED20) (NM_004275) Human Recombinant Protein

View all MED20 recombinant proteins

SKU/Catalog Number

PROTQ9H944

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mediator complex subunit 20 (MED20)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

trfp (MED20) (NM_004275) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H944)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23 kDa

Amino Acid Sequence

MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAGIR

Validation Images & Assay Conditions

Gene/Protein Information For MED20 (Source: Uniprot.org, NCBI)

Gene Name

MED20

Full Name

Mediator of RNA polymerase II transcription subunit 20

Weight

23 kDa

Superfamily

Mediator complex subunit 20 family

Alternative Names

hTRFP; mediator complex subunit 20MGC29869; mediator of RNA polymerase II transcription subunit 20; PRO0213; Trf (TATA binding protein-related factor)-proximal homolog (Drosophila); Trf (TATA binding protein-related factor)-proximal homolog; TRFPDKFZp586D2223; TRF-proximal protein homolog MED20 PRO0213, SRB2, TRFP mediator complex subunit 20 mediator of RNA polymerase II transcription subunit 20|Trf (TATA binding protein-related factor)-proximal homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MED20, check out the MED20 Infographic

MED20 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MED20: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H944

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used trfp (MED20) (NM_004275) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For trfp (MED20) (NM_004275) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for trfp (MED20) (NM_004275) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H944
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.