Tpit (TBX19) (NM_005149) Human Recombinant Protein

T-box 19 protein,

Recombinant protein of human T-box 19 (TBX19)

Product Info Summary

SKU: PROTO60806
Size: 20 µg
Source: HEK293T

Product Name

Tpit (TBX19) (NM_005149) Human Recombinant Protein

View all T-box 19 recombinant proteins

SKU/Catalog Number

PROTO60806

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human T-box 19 (TBX19)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Tpit (TBX19) (NM_005149) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60806)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

48.1 kDa

Amino Acid Sequence

MAMSELGTRKPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRMFPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRMVTNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCTAGNSNYQYAAPLPLPAPHTHHGCEHYSGLRGHRQAPYPSAYMHRNHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGPSPYPCLWTISNGAGGPSGPGPEVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG

Validation Images & Assay Conditions

Gene/Protein Information For TBX19 (Source: Uniprot.org, NCBI)

Gene Name

TBX19

Full Name

T-box transcription factor TBX19

Weight

48.1 kDa

Alternative Names

dJ747L4.1; FLJ26302; FLJ34085; T-box 19; T-box factor, pituitary; T-box protein 19; T-box transcription factor TBX19; TBS 19; TBS19; TPITFLJ34543 TBX19 TBS19, TPIT, dJ747L4.1 T-box transcription factor 19 T-box transcription factor TBX19|T-box 19|T-box factor, pituitary|T-box protein 19|TBS 19

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TBX19, check out the TBX19 Infographic

TBX19 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TBX19: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60806

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Tpit (TBX19) (NM_005149) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Tpit (TBX19) (NM_005149) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Tpit (TBX19) (NM_005149) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60806
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.