CRSP9 (MED7) (NM_004270) Human Recombinant Protein

MED7 protein,

Product Info Summary

SKU: PROTO43513
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CRSP9 (MED7) (NM_004270) Human Recombinant Protein

View all MED7 recombinant proteins

SKU/Catalog Number

PROTO43513

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mediator complex subunit 7 (MED7), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CRSP9 (MED7) (NM_004270) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43513)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.1 kDa

Amino Acid Sequence

MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP

Validation Images & Assay Conditions

Gene/Protein Information For MED7 (Source: Uniprot.org, NCBI)

Gene Name

MED7

Full Name

Mediator of RNA polymerase II transcription subunit 7

Weight

27.1 kDa

Superfamily

Mediator complex subunit 7 family

Alternative Names

Activator-recruited cofactor 34 kDa component; Cofactor required for Sp1 transcriptional activation subunit 9; cofactor required for Sp1 transcriptional activation, subunit 9 (33kD); cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa; CRSP33CRSP complex subunit 9; CRSP9hMED7; mediator complex subunit 7ARC34; mediator of RNA polymerase II transcription subunit 7; MGC12284; RNA polymerase transcriptional regulation mediator subunit 7 homolog; Transcriptional coactivator CRSP33 MED7 ARC34, CRSP33, CRSP9 mediator complex subunit 7 mediator of RNA polymerase II transcription subunit 7|CRSP complex subunit 9|RNA polymerase transcriptional regulation mediator subunit 7 homolog|activator-recruited cofactor 34 kDa component|cofactor required for Sp1 transcriptional activation subunit 9|cofactor required for Sp1 transcriptional activation, subunit 9 (33kD)|cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa|transcriptional coactivator CRSP33

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MED7, check out the MED7 Infographic

MED7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MED7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43513

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CRSP9 (MED7) (NM_004270) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CRSP9 (MED7) (NM_004270) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CRSP9 (MED7) (NM_004270) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43513
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.