Guanylate kinase (GUK1) (NM_000858) Human Recombinant Protein

Guanylate kinase protein,

Product Info Summary

SKU: PROTQ16774
Size: 20 µg
Source: HEK293T

Product Name

Guanylate kinase (GUK1) (NM_000858) Human Recombinant Protein

View all Guanylate kinase recombinant proteins

SKU/Catalog Number

PROTQ16774

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human guanylate kinase 1 (GUK1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Guanylate kinase (GUK1) (NM_000858) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16774)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.5 kDa

Amino Acid Sequence

MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA

Validation Images & Assay Conditions

Gene/Protein Information For GUK1 (Source: Uniprot.org, NCBI)

Gene Name

GUK1

Full Name

Guanylate kinase

Weight

21.5 kDa

Superfamily

guanylate kinase family

Alternative Names

ATP:GMP Phosphotransferase; Deoxyguanylate Kinase; EC 2.7.4.8; FLJ42686; FLJ43710; GMK; GMP Kinase; Guanosine monophosphate Kinase; guanylate kinase 1; Guanylate Kinase; GUK1 GUK1 GMK guanylate kinase 1 guanylate kinase|ATP:GMP phosphotransferase|GMP kinase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GUK1, check out the GUK1 Infographic

GUK1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GUK1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16774

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Guanylate kinase (GUK1) (NM_000858) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Guanylate kinase (GUK1) (NM_000858) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Guanylate kinase (GUK1) (NM_000858) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16774
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.