TMUB1 (NM_001136044) Human Recombinant Protein

Tmub1 protein,

Recombinant protein of human transmembrane and ubiquitin-like domain containing 1 (TMUB1), transcript variant 2

Product Info Summary

SKU: PROTQ9BVT8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TMUB1 (NM_001136044) Human Recombinant Protein

View all Tmub1 recombinant proteins

SKU/Catalog Number

PROTQ9BVT8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human transmembrane and ubiquitin-like domain containing 1 (TMUB1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TMUB1 (NM_001136044) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BVT8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.1 kDa

Amino Acid Sequence

MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP

Validation Images & Assay Conditions

Gene/Protein Information For TMUB1 (Source: Uniprot.org, NCBI)

Gene Name

TMUB1

Full Name

Transmembrane and ubiquitin-like domain-containing protein 1

Weight

26.1 kDa

Alternative Names

C7orf21; chromosome 7 open reading frame 21; DULP; Hepatocyte odd protein shuttling protein; HOPS; MGC5442; SB144; transmembrane and ubiquitin-like domain containing 1; transmembrane and ubiquitin-like domain-containing protein 1; Ubiquitin-like protein DULP; Ubiquitin-like protein SB144 Tmub1|2010004O20Rik, AB030183, H, Hops|transmembrane and ubiquitin-like domain containing 1|transmembrane and ubiquitin-like domain-containing protein 1|hepatocyte odd protein shuttling protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TMUB1, check out the TMUB1 Infographic

TMUB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TMUB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BVT8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TMUB1 (NM_001136044) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TMUB1 (NM_001136044) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TMUB1 (NM_001136044) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BVT8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.