CAMLG (NM_001745) Human Recombinant Protein

CAMLG protein,

Product Info Summary

SKU: PROTP49069
Size: 20 µg
Source: HEK293T

Product Name

CAMLG (NM_001745) Human Recombinant Protein

View all CAMLG recombinant proteins

SKU/Catalog Number

PROTP49069

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human calcium modulating ligand (CAMLG)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CAMLG (NM_001745) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP49069)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.8 kDa

Amino Acid Sequence

MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP

Validation Images & Assay Conditions

Gene/Protein Information For CAMLG (Source: Uniprot.org, NCBI)

Gene Name

CAMLG

Full Name

Calcium signal-modulating cyclophilin ligand

Weight

32.8 kDa

Alternative Names

calcium modulating ligand; calcium signal-modulating cyclophilin ligand; calcium-signal modulating cyclophilin ligand; CAMLcalcium-modulating cyclophilin ligand; cyclophilin B-binding protein; MGC163197 CAMLG CAML, GET2 calcium modulating ligand calcium signal-modulating cyclophilin ligand|calcium-modulating cyclophilin ligand|cyclophilin B-binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CAMLG, check out the CAMLG Infographic

CAMLG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CAMLG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP49069

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CAMLG (NM_001745) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CAMLG (NM_001745) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CAMLG (NM_001745) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP49069
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.