TMEM88 (NM_203411) Human Recombinant Protein

Tmem88 protein,

Recombinant protein of human transmembrane protein 88 (TMEM88)

Product Info Summary

SKU: PROTQ6PEY1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TMEM88 (NM_203411) Human Recombinant Protein

View all Tmem88 recombinant proteins

SKU/Catalog Number

PROTQ6PEY1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human transmembrane protein 88 (TMEM88)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TMEM88 (NM_203411) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6PEY1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.1 kDa

Amino Acid Sequence

MADVPGAQRAVPGDGPEPRDPLDCWACAVLVTAQNLLVAAFNLLLLVLVLGTILLPAVTMLGFGFLCHSQFLRSQAPPCTAHLRDPGFTALLVTGFLLLVPLLVLALASYRRLCLRLRLADCLVPYSRALYRRRRAPQPRQIRASPGSQAVPTSGKVWV

Validation Images & Assay Conditions

Gene/Protein Information For TMEM88 (Source: Uniprot.org, NCBI)

Gene Name

TMEM88

Full Name

Transmembrane protein 88

Weight

17.1 kDa

Superfamily

TMEM88 family

Alternative Names

FLJ20025; MGC71744; TMEM88; TMEM88A; transmembrane protein 88

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TMEM88, check out the TMEM88 Infographic

TMEM88 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TMEM88: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6PEY1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TMEM88 (NM_203411) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TMEM88 (NM_203411) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TMEM88 (NM_203411) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6PEY1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.