Swine recombinant FGF-2 (Fibroblast growth factor-2) protein, AF

FGF basic/FGF2/bFGF protein, Swine

Basic fibroblast Growth Factors (FGF-2, bFGF), a pleiotropic cytokine, plays multiple roles in different cells and tissues. FGF-2 can stimulate smooth muscle cell growth, wound healing, and tissue repair. In addition, FGF-2 has been shown to regulate the generation of neurons and astrocytes from progenitor cells. FGF-2 are also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth, and invasion. As a multifunctional cytokine, FGF-2 is first isolated from the pituitary. Later, it was identified from various cell types including cardiac myocytes, cardiac fibroblasts, endothelial cells, and smooth muscle cells.

Product Info Summary

SKU: PROTA0A287BGK8
Size: 5ug,20ug
Origin Species: Swine
Source: Escherichia coli
Application: Cell Culture

Product Name

Swine recombinant FGF-2 (Fibroblast growth factor-2) protein, AF

View all FGF basic/FGF2/bFGF recombinant proteins

SKU/Catalog Number

PROTA0A287BGK8

Size

5ug,20ug

Tag

His Tag (N-term)

Description

Basic fibroblast Growth Factors (FGF-2, bFGF), a pleiotropic cytokine, plays multiple roles in different cells and tissues. FGF-2 can stimulate smooth muscle cell growth, wound healing, and tissue repair. In addition, FGF-2 has been shown to regulate the generation of neurons and astrocytes from progenitor cells. FGF-2 are also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth, and invasion. As a multifunctional cytokine, FGF-2 is first isolated from the pituitary. Later, it was identified from various cell types including cardiac myocytes, cardiac fibroblasts, endothelial cells, and smooth muscle cells.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Swine recombinant FGF-2 (Fibroblast growth factor-2) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA0A287BGK8)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 0.01% sarkosyl in 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

30.77kDa

Molecular weight

The protein has a calculated MW of 18.1 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce proliferation in 3T3 cells. The ED₅₀ for this effect is <2 ng/mL.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For FGF2 (Source: Uniprot.org, NCBI)

Gene Name

FGF2

Full Name

Fibroblast growth factor 2

Weight

30.77kDa

Superfamily

heparin-binding growth factors family

Alternative Names

Fgfb, bFGF, FGF-basic FGF2 BFGF, FGF-2, FGFB, HBGF-2 fibroblast growth factor 2 fibroblast growth factor 2|basic fibroblast growth factor bFGF|fibroblast growth factor 2 (basic)|heparin-binding growth factor 2|prostatropin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FGF2, check out the FGF2 Infographic

FGF2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FGF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA0A287BGK8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Swine recombinant FGF-2 (Fibroblast growth factor-2) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Swine recombinant FGF-2 (Fibroblast growth factor-2) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Swine recombinant FGF-2 (Fibroblast growth factor-2) protein, AF

Size

Total: $154

SKU:PROTA0A287BGK8

Backordered.

Lead time for this item is typically 2-4 weeks

Get A Quote
In stock
Order Product
PROTA0A287BGK8
$154.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.