Sumo 3 (SUMO3) (NM_006936) Human Recombinant Protein

SUMO3 protein,

Product Info Summary

SKU: PROTP55854
Size: 20 µg
Source: HEK293T

Product Name

Sumo 3 (SUMO3) (NM_006936) Human Recombinant Protein

View all SUMO3 recombinant proteins

SKU/Catalog Number

PROTP55854

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Sumo 3 (SUMO3) (NM_006936) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP55854)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.5 kDa

Amino Acid Sequence

MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

Validation Images & Assay Conditions

Gene/Protein Information For SUMO3 (Source: Uniprot.org, NCBI)

Gene Name

SUMO3

Full Name

Small ubiquitin-related modifier 3

Weight

11.5 kDa

Superfamily

ubiquitin family

Alternative Names

SMT3 (suppressor of mif two 3, yeast) homolog 1; SMT3 homolog 1; SMT3 suppressor of mif two 3 homolog 1; SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 3 (yeast); SMT3A; SMT3B; SMT3H1; SMT3H1small ubiquitin-related modifier 3; SUMO-2; SUMO3; SUMO-3; ubiquitin-like protein SMT3A; Ubiquitin-like protein SMT3B SUMO3 SMT3A, SMT3H1, SUMO-3, Smt3B small ubiquitin like modifier 3 small ubiquitin-related modifier 3|SMT3 suppressor of mif two 3 homolog 1|SMT3 suppressor of mif two 3 homolog 3|ubiquitin-like protein SMT3B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SUMO3, check out the SUMO3 Infographic

SUMO3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SUMO3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP55854

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Sumo 3 (SUMO3) (NM_006936) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Sumo 3 (SUMO3) (NM_006936) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Sumo 3 (SUMO3) (NM_006936) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP55854
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.