SULT1A4 (NM_001017391) Human Recombinant Protein

SULT1A3/SULT1A4 protein,

Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4 (SULT1A4), transcript variant 3

Product Info Summary

SKU: PROTP0DMN0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SULT1A4 (NM_001017391) Human Recombinant Protein

View all SULT1A3/SULT1A4 recombinant proteins

SKU/Catalog Number

PROTP0DMN0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4 (SULT1A4), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SULT1A4 (NM_001017391) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP0DMN0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34 kDa

Amino Acid Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Validation Images & Assay Conditions

Gene/Protein Information For SULT1A4 (Source: Uniprot.org, NCBI)

Gene Name

SULT1A4

Full Name

Sulfotransferase 1A4

Weight

34 kDa

Superfamily

sulfotransferase 1 family

Alternative Names

Aryl sulfotransferase 1A3/1A4; Catecholamine-sulfating phenol sulfotransferase; EC 2.8.2; EC 2.8.2.1; FLJ54864; HAST3; Monoamine-sulfating phenol sulfotransferase; M-PST; Placental estrogen sulfotransferase; ST1A3/ST1A4; STM; sulfokinase; sulfotransferase 1A3/1A4; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4; Sulfotransferase, monoamine-preferring; Thermolabile phenol sulfotransferase; TL-PST SULT1A4 HAST3, M-PST, ST1A3, ST1A3/ST1A4, ST1A4, STM, TL-PST sulfotransferase family 1A member 4 sulfotransferase 1A4|SLX1B-SULT1A4|Sulfotransferase 1A3|aryl sulfotransferase 1A3/1A4|catecholamine-sulfating phenol sulfotransferase|monoamine-sulfating phenol sulfotransferase|placental estrogen sulfotransferase|sulfokinase|sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4|sulfotransferase, monoamine-preferring|thermolabile phenol sulfotransferase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SULT1A4, check out the SULT1A4 Infographic

SULT1A4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SULT1A4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP0DMN0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SULT1A4 (NM_001017391) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SULT1A4 (NM_001017391) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SULT1A4 (NM_001017391) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP0DMN0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.