NR1D2 (NM_005126) Human Recombinant Protein

Rev-erb beta/NR1D2 protein,

Recombinant protein of human nuclear receptor subfamily 1, group D, member 2 (NR1D2), transcript variant 1

Product Info Summary

SKU: PROTQ14995
Size: 20 µg
Source: HEK293T

Product Name

NR1D2 (NM_005126) Human Recombinant Protein

View all Rev-erb beta/NR1D2 recombinant proteins

SKU/Catalog Number

PROTQ14995

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nuclear receptor subfamily 1, group D, member 2 (NR1D2), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NR1D2 (NM_005126) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ14995)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

64.5 kDa

Amino Acid Sequence

MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP

Validation Images & Assay Conditions

Gene/Protein Information For NR1D2 (Source: Uniprot.org, NCBI)

Gene Name

NR1D2

Full Name

Nuclear receptor subfamily 1 group D member 2

Weight

64.5 kDa

Superfamily

nuclear hormone receptor family

Alternative Names

BD73; EAR-1R; HZF2; NR1D2; nuclear receptor subfamily 1 group D member 2; nuclear receptor subfamily 1, group D, member 2; Orphan nuclear hormone receptor BD73; Reverb beta; Rev-erb beta; rev-erba-alpha-related receptor; rev-erb-beta; RVR; V-erbA-related protein 1-related NR1D2 BD73, EAR-1R, REVERBB, REVERBbeta, RVR nuclear receptor subfamily 1 group D member 2 nuclear receptor subfamily 1 group D member 2|V-erbA-related protein 1-related|nuclear receptor Rev-ErbA beta variant 1|nuclear receptor Rev-ErbA beta variant 2|orphan nuclear hormone receptor BD73|rev-erb alpha-related receptor|rev-erb-beta|rev-erba-alpha-related receptor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NR1D2, check out the NR1D2 Infographic

NR1D2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NR1D2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ14995

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NR1D2 (NM_005126) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NR1D2 (NM_005126) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NR1D2 (NM_005126) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ14995
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.