Spasmolytic Polypeptide (TFF2) (NM_005423) Human Recombinant Protein

TFF2 protein,

Product Info Summary

SKU: PROTQ03403
Size: 20 µg
Source: HEK293T

Product Name

Spasmolytic Polypeptide (TFF2) (NM_005423) Human Recombinant Protein

View all TFF2 recombinant proteins

SKU/Catalog Number

PROTQ03403

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human trefoil factor 2 (TFF2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Spasmolytic Polypeptide (TFF2) (NM_005423) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ03403)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.9 kDa

Amino Acid Sequence

MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Validation Images & Assay Conditions

Gene/Protein Information For TFF2 (Source: Uniprot.org, NCBI)

Gene Name

TFF2

Full Name

Trefoil factor 2

Weight

11.9 kDa

Alternative Names

SML1; SML1trefoil factor 2, SML1, human spasmolytic polypeptide (SP)10spasmolytic protein 1; SP; Spasmolysin; Spasmolytic Polypeptide; TFF2; trefoil factor 2 TFF2 SML1, SP trefoil factor 2 trefoil factor 2|spasmolysin|spasmolytic polypeptide|spasmolytic protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TFF2, check out the TFF2 Infographic

TFF2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TFF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ03403

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Spasmolytic Polypeptide (TFF2) (NM_005423) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Spasmolytic Polypeptide (TFF2) (NM_005423) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Spasmolytic Polypeptide (TFF2) (NM_005423) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ03403
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product