SPRR2A (NM_005988) Human Recombinant Protein

SPRR2A protein,

Recombinant protein of human small proline-rich protein 2A (SPRR2A)

Product Info Summary

SKU: PROTP35326
Size: 20 µg
Source: HEK293T

Product Name

SPRR2A (NM_005988) Human Recombinant Protein

View all SPRR2A recombinant proteins

SKU/Catalog Number

PROTP35326

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human small proline-rich protein 2A (SPRR2A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SPRR2A (NM_005988) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP35326)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

7.8 kDa

Amino Acid Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK

Validation Images & Assay Conditions

Gene/Protein Information For SPRR2A (Source: Uniprot.org, NCBI)

Gene Name

SPRR2A

Full Name

Small proline-rich protein 2A

Weight

7.8 kDa

Superfamily

cornifin (SPRR) family

Alternative Names

2-1; small proline-rich protein 2A; SPR-2A SPRR2A small proline rich protein 2A small proline-rich protein 2A|2-1|SPR-2A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SPRR2A, check out the SPRR2A Infographic

SPRR2A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SPRR2A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP35326

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SPRR2A (NM_005988) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SPRR2A (NM_005988) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SPRR2A (NM_005988) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP35326
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.