SKP1 (NM_170679) Human Recombinant Protein

SKP1 protein,

Product Info Summary

SKU: PROTP63208
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SKP1 (NM_170679) Human Recombinant Protein

View all SKP1 recombinant proteins

SKU/Catalog Number

PROTP63208

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human S-phase kinase-associated protein 1 (SKP1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SKP1 (NM_170679) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP63208)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.5 kDa

Amino Acid Sequence

MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

Validation Images & Assay Conditions

Gene/Protein Information For SKP1 (Source: Uniprot.org, NCBI)

Gene Name

SKP1

Full Name

S-phase kinase-associated protein 1

Weight

18.5 kDa

Superfamily

SKP1 family

Alternative Names

Cyclin-A/CDK2-associated protein p19; EMC19p19skp1; MGC34403; OCP2; OCP2OCP-2; OCP-IIS-phase kinase-associated protein 1A (p19A); Organ of Corti protein 2; Organ of Corti protein II; p19a; p19Acyclin A/CDK2-associated p19; p19Skp1; RNA polymerase II elongation factor-like protein OCP2; RNA polymerase II elongation factor-like protein; SKP1; SKP1A; SKP1Acyclin A/CDK2-associated protein p19; S-phase kinase-associated protein 1; TCEB1LSIII; Transcription elongation factor B SKP1 EMC19, OCP-II, OCP2A, TCEB1L, p19A, SKP1 S-phase kinase associated protein 1 S-phase kinase-associated protein 1|OCP-2|RNA polymerase II elongation factor-like protein OCP2|SIII|cyclin A/CDK2-associated p19|cyclin-A/CDK2-associated protein p19|organ of Corti protein 2|organ of Corti protein II|p19skp1|transcription elongation factor B polypeptide 1-like

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SKP1, check out the SKP1 Infographic

SKP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SKP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP63208

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SKP1 (NM_170679) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SKP1 (NM_170679) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SKP1 (NM_170679) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP63208
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.