SH3GLB2 (NM_020145) Human Recombinant Protein

SH3GLB2 protein,

Product Info Summary

SKU: PROTQ9NR46
Size: 20 µg
Source: HEK293T

Product Name

SH3GLB2 (NM_020145) Human Recombinant Protein

View all SH3GLB2 recombinant proteins

SKU/Catalog Number

PROTQ9NR46

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SH3-domain GRB2-like endophilin B2 (SH3GLB2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SH3GLB2 (NM_020145) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NR46)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

43.8 kDa

Amino Acid Sequence

MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS

Validation Images & Assay Conditions

Gene/Protein Information For SH3GLB2 (Source: Uniprot.org, NCBI)

Gene Name

SH3GLB2

Full Name

Endophilin-B2

Weight

43.8 kDa

Superfamily

endophilin family

Alternative Names

endophilin-B2; GRB2-like, endophilin B2; SH3-containing protein SH3GLB2; SH3-domain GRB2-like endophilin B2 SH3GLB2 PP6569, PP9455, RRIG1 SH3 domain containing GRB2 like, endophilin B2 endophilin-B2|SH3 domain-containing GRB2-like protein B2|SH3-containing protein SH3GLB2|SH3-domain GRB2-like endophilin B2|retinoid receptor-induced gene 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SH3GLB2, check out the SH3GLB2 Infographic

SH3GLB2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SH3GLB2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NR46

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SH3GLB2 (NM_020145) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SH3GLB2 (NM_020145) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SH3GLB2 (NM_020145) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NR46
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.