SCNM1 (NM_024041) Human Recombinant Protein

Scnm1 protein,

Recombinant protein of human sodium channel modifier 1 (SCNM1)

Product Info Summary

SKU: PROTQ9BWG6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SCNM1 (NM_024041) Human Recombinant Protein

View all Scnm1 recombinant proteins

SKU/Catalog Number

PROTQ9BWG6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sodium channel modifier 1 (SCNM1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SCNM1 (NM_024041) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BWG6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.8 kDa

Amino Acid Sequence

MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLSSLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPSVSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWVKDENVEFDSDEEEPPDLPLD

Validation Images & Assay Conditions

Gene/Protein Information For Scnm1 (Source: Uniprot.org, NCBI)

Gene Name

Scnm1

Full Name

Sodium channel modifier 1

Weight

25.8 kDa

Alternative Names

MGC3180; sodium channel modifier 1 Scnm1|3110001I17Rik, Scnm-ps, Scnm1|sodium channel modifier 1|sodium channel modifier 1|sodium channel modifier 1, pseudogene

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Scnm1, check out the Scnm1 Infographic

Scnm1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Scnm1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BWG6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SCNM1 (NM_024041) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SCNM1 (NM_024041) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SCNM1 (NM_024041) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BWG6
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.