SAP18 (NM_005870) Human Recombinant Protein

SAP18 protein,

Product Info Summary

SKU: PROTO00422
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SAP18 (NM_005870) Human Recombinant Protein

View all SAP18 recombinant proteins

SKU/Catalog Number

PROTO00422

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Sin3A-associated protein, 18kDa (SAP18)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SAP18 (NM_005870) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO00422)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.4 kDa

Amino Acid Sequence

MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPTSGRMRPY

Validation Images & Assay Conditions

Gene/Protein Information For SAP18 (Source: Uniprot.org, NCBI)

Gene Name

SAP18

Full Name

Histone deacetylase complex subunit SAP18

Weight

17.4 kDa

Superfamily

SAP18 family

Alternative Names

2HOR0202cell growth inhibiting protein 38; Cell growth-inhibiting gene 38 protein; cell growth-inhibiting protein 38; histone deacetlyase complex subunit SAP18; histone deacetylase complex subunit SAP18,18 kDa Sin3-associated polypeptide; MGC27131; SAP18P; Sin3A-associated protein, 18kDa; Sin3-associated polypeptide p18; sin3-associated polypeptide, 18 kDa; sin3-associated polypeptide, p18 SAP18 2HOR0202P, SAP18 Sin3A associated protein 18 histone deacetylase complex subunit SAP18|18 kDa Sin3-associated polypeptide|Sin3A-associated protein, 18kDa|cell growth inhibiting protein 38|cell growth-inhibiting gene 38 protein|epididymis secretory sperm binding protein|histone deacetlyase complex subunit SAP18|sin3-associated polypeptide, 18 kDa|sin3-associated polypeptide, p18

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SAP18, check out the SAP18 Infographic

SAP18 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SAP18: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO00422

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SAP18 (NM_005870) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SAP18 (NM_005870) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SAP18 (NM_005870) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO00422
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.