RUNX1T1 (NM_175636) Human Recombinant Protein

RUNX1T1/ETO protein,

Recombinant protein of human runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 4

Product Info Summary

SKU: PROTQ06455
Size: 20 µg
Source: HEK293T

Product Name

RUNX1T1 (NM_175636) Human Recombinant Protein

View all RUNX1T1/ETO recombinant proteins

SKU/Catalog Number

PROTQ06455

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human runt-related transcription factor 1; translocated to, 1 (cyclin D-related) (RUNX1T1), transcript variant 4

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RUNX1T1 (NM_175636) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ06455)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

63 kDa

Amino Acid Sequence

MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR

Validation Images & Assay Conditions

Gene/Protein Information For RUNX1T1 (Source: Uniprot.org, NCBI)

Gene Name

RUNX1T1

Full Name

Protein CBFA2T1

Weight

63 kDa

Superfamily

CBFA2T family

Alternative Names

AML1T1protein CBFA2T1; CBFA2T1Cyclin-D-related protein; CDRMGC2796; core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related; DKFZp564B213; Eight twenty one protein; ETOFLJ33145; MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related; Protein ETO; Protein MTG8; runt-related transcription factor 1; translocated to, 1 (cyclin D-related); Zinc finger MYND domain-containing protein 2; ZMYND2myeloid translocation gene on 8q22 RUNX1T1 AML1-MTG8, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2 RUNX1 partner transcriptional co-repressor 1 protein CBFA2T1|RUNX1 translocation partner 1|acute myelogenous leukemia 1 translocation 1, cyclin-D related|core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclin D-related|eight twenty one protein|myeloid translocation gene on 8q22|runt related transcription factor 1; translocated to, 1 (cyclin D related)|zinc finger MYND domain-containing protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RUNX1T1, check out the RUNX1T1 Infographic

RUNX1T1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RUNX1T1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ06455

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RUNX1T1 (NM_175636) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RUNX1T1 (NM_175636) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RUNX1T1 (NM_175636) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ06455
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product