RTN4RL2 (NM_178570) Human Recombinant Protein

NgR2/NgRH1/RTN4RL2 protein,

Purified recombinant protein of Homo sapiens reticulon 4 receptor-like 2 (RTN4RL2)

Product Info Summary

SKU: PROTQ86UN3
Size: 20 µg
Source: HEK293T

Product Name

RTN4RL2 (NM_178570) Human Recombinant Protein

View all NgR2/NgRH1/RTN4RL2 recombinant proteins

SKU/Catalog Number

PROTQ86UN3

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens reticulon 4 receptor-like 2 (RTN4RL2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RTN4RL2 (NM_178570) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ86UN3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

45.9 kDa

Amino Acid Sequence

MLPGLRRLLQAPASACLLLMLLALPLAAPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRTLRPGTFGSNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFRGLSRLTILYLFNNSLASLPGEALADLPSLEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLRALREADFQACPPAAPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQMCPGAACQAPPDSRGPALSAGLPSPLLCLLLLVPHHL

Validation Images & Assay Conditions

Gene/Protein Information For RTN4RL2 (Source: Uniprot.org, NCBI)

Gene Name

RTN4RL2

Full Name

Reticulon-4 receptor-like 2

Weight

45.9 kDa

Superfamily

Nogo receptor family

Alternative Names

NgR2; NgRH1; reticulon 4 receptor-like 2; RTN4RL2 Rtn4rl2|Ng, Ngr, Ngr2, Ngrh1, Ngrl3|reticulon 4 receptor-like 2|reticulon-4 receptor-like 2|nogo receptor-like 3|nogo-66 receptor homolog 1|nogo-66 receptor-related protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RTN4RL2, check out the RTN4RL2 Infographic

RTN4RL2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RTN4RL2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ86UN3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RTN4RL2 (NM_178570) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RTN4RL2 (NM_178570) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RTN4RL2 (NM_178570) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ86UN3
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.