RRAS2 (NM_012250) Human Recombinant Protein

TC21/R-Ras2 protein,

Product Info Summary

SKU: PROTP62070
Size: 20 µg
Source: HEK293T

Product Name

RRAS2 (NM_012250) Human Recombinant Protein

View all TC21/R-Ras2 recombinant proteins

SKU/Catalog Number

PROTP62070

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RRAS2 (NM_012250) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP62070)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.2 kDa

Amino Acid Sequence

MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF

Validation Images & Assay Conditions

Gene/Protein Information For RRAS2 (Source: Uniprot.org, NCBI)

Gene Name

RRAS2

Full Name

Ras-related protein R-Ras2

Weight

23.2 kDa

Superfamily

small GTPase superfamily

Alternative Names

ras-related protein R-Ras2; related RAS viral (r-ras) oncogene homolog 2; RRAS2; TC21; TC21Ras-like protein TC21; Teratocarcinoma oncogene RRAS2 NS12, TC21 RAS related 2 ras-related protein R-Ras2|ras-like protein TC21|related RAS viral (r-ras) oncogene homolog 2|teratocarcinoma oncogene

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RRAS2, check out the RRAS2 Infographic

RRAS2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RRAS2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used RRAS2 (NM_012250) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RRAS2 (NM_012250) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RRAS2 (NM_012250) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP62070
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.