RNF2 (NM_007212) Human Recombinant Protein

RNF2 protein,

Recombinant protein of human ring finger protein 2 (RNF2)

Product Info Summary

SKU: PROTQ99496
Size: 20 µg
Source: HEK293T

Product Name

RNF2 (NM_007212) Human Recombinant Protein

View all RNF2 recombinant proteins

SKU/Catalog Number

PROTQ99496

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ring finger protein 2 (RNF2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RNF2 (NM_007212) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ99496)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37.5 kDa

Amino Acid Sequence

MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK

Validation Images & Assay Conditions

Gene/Protein Information For RNF2 (Source: Uniprot.org, NCBI)

Gene Name

RNF2

Full Name

E3 ubiquitin-protein ligase RING2

Weight

37.5 kDa

Alternative Names

BAP-1; BAP1RING finger protein 1B; DING; DINGRING finger protein BAP-1; EC 6.3.2; HIPI3; HIPI3RING1BE3 ubiquitin-protein ligase RING2; Huntingtin-interacting protein 2-interacting protein 3; Protein DinG; ring finger protein 2HIP2-interacting protein 3; RING1B; RING2; RING2EC 6.3.2.-; RNF2 RNF2 BAP-1, BAP1, DING, HIPI3, RING1B, RING2 ring finger protein 2 E3 ubiquitin-protein ligase RING2|HIP2-interacting protein 3|RING finger protein 1B|RING finger protein BAP-1|RING-type E3 ubiquitin transferase RING2|huntingtin-interacting protein 2-interacting protein 3|protein DinG

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RNF2, check out the RNF2 Infographic

RNF2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RNF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ99496

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RNF2 (NM_007212) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RNF2 (NM_007212) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RNF2 (NM_007212) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ99496
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.