RHOC (NM_001042678) Human Recombinant Protein

RHOC protein,

Product Info Summary

SKU: PROTP08134
Size: 20 µg
Source: HEK293T

Product Name

RHOC (NM_001042678) Human Recombinant Protein

View all RHOC recombinant proteins

SKU/Catalog Number

PROTP08134

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ras homolog gene family, member C (RHOC), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RHOC (NM_001042678) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP08134)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.8 kDa

Amino Acid Sequence

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL

Validation Images & Assay Conditions

Gene/Protein Information For RHOC (Source: Uniprot.org, NCBI)

Gene Name

RHOC

Full Name

Rho-related GTP-binding protein RhoC

Weight

21.8 kDa

Superfamily

small GTPase superfamily

Alternative Names

ARH9ARHCRho cDNA clone 9; H9; MGC1448; MGC61427; oncogene RHO H9; ras homolog gene family, member C; RAS-related homolog 9; rhoC GTPase; RhoC; RHOH9; rho-related GTP-binding protein RhoC; small GTP binding protein RhoC RHOC ARH9, ARHC, H9, RHOH9 ras homolog family member C rho-related GTP-binding protein RhoC|RAS-related homolog 9|epididymis secretory sperm binding protein|oncogene RHO H9|ras homolog gene family, member C|rho cDNA clone 9|rhoC GTPase|small GTP binding protein RhoC

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RHOC, check out the RHOC Infographic

RHOC infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RHOC: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP08134

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RHOC (NM_001042678) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RHOC (NM_001042678) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RHOC (NM_001042678) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP08134
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.