Retinal protein 4 (UNC119) (NM_005148) Human Recombinant Protein

UNC119 protein,

Recombinant protein of human unc-119 homolog (C. elegans) (UNC119), transcript variant 1

Product Info Summary

SKU: PROTQ13432
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Retinal protein 4 (UNC119) (NM_005148) Human Recombinant Protein

View all UNC119 recombinant proteins

SKU/Catalog Number

PROTQ13432

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human unc-119 homolog (C. elegans) (UNC119), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Retinal protein 4 (UNC119) (NM_005148) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13432)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.8 kDa

Amino Acid Sequence

MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP

Validation Images & Assay Conditions

Gene/Protein Information For UNC119 (Source: Uniprot.org, NCBI)

Gene Name

UNC119

Full Name

Protein unc-119 homolog A

Weight

26.8 kDa

Superfamily

PDE6D/unc-119 family

Alternative Names

hRG4; HRG4POC7 centriolar protein homolog A; POC7; POC7A; protein unc-119 homolog A; Retinal protein 4; RG4; unc119 (C.elegans) homolog; unc-119 homolog (C. elegans) UNC119 HRG4, IMD13, POC7, POC7A unc-119 lipid binding chaperone protein unc-119 homolog A|POC7 centriolar protein homolog A|retinal protein 4|unc-119 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on UNC119, check out the UNC119 Infographic

UNC119 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UNC119: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13432

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Retinal protein 4 (UNC119) (NM_005148) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Retinal protein 4 (UNC119) (NM_005148) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Retinal protein 4 (UNC119) (NM_005148) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13432
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.