Renalase (RNLS) (NM_001031709) Human Recombinant Protein

Renalase protein,

Product Info Summary

SKU: PROTQ5VYX0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Renalase (RNLS) (NM_001031709) Human Recombinant Protein

View all Renalase recombinant proteins

SKU/Catalog Number

PROTQ5VYX0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 10 open reading frame 59 (C10orf59), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Renalase (RNLS) (NM_001031709) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5VYX0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37.7 kDa

Amino Acid Sequence

MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI

Validation Images & Assay Conditions

Gene/Protein Information For RNLS (Source: Uniprot.org, NCBI)

Gene Name

RNLS

Full Name

Renalase

Weight

37.7 kDa

Superfamily

renalase family

Alternative Names

C10orf59; C10orf59chromosome 10 open reading frame 59; EC 1.4; FLJ11218; MAO-C; Monoamine oxidase-C; Renalase; renalase, FAD-dependent amine oxidase; RNLS RNLS C10orf59, RENALASE renalase, FAD dependent amine oxidase renalase|MAO-C|alpha-NAD(P)H oxidase/anomerase|monoamine oxidase-C

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RNLS, check out the RNLS Infographic

RNLS infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RNLS: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5VYX0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Renalase (RNLS) (NM_001031709) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Renalase (RNLS) (NM_001031709) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Renalase (RNLS) (NM_001031709) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5VYX0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.