RASD2 (NM_014310) Human Recombinant Protein

RASD2 protein,

Product Info Summary

SKU: PROTQ96D21
Size: 20 µg
Source: HEK293T

Product Name

RASD2 (NM_014310) Human Recombinant Protein

View all RASD2 recombinant proteins

SKU/Catalog Number

PROTQ96D21

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RASD family, member 2 (RASD2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RASD2 (NM_014310) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96D21)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.2 kDa

Amino Acid Sequence

MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ

Validation Images & Assay Conditions

Gene/Protein Information For RASD2 (Source: Uniprot.org, NCBI)

Gene Name

RASD2

Full Name

GTP-binding protein Rhes

Weight

30.2 kDa

Superfamily

small GTPase superfamily

Alternative Names

GTP-binding protein Rhes; MGC:4834; RASD family, member 2; Rhes; TEM2Ras homolog enriched in striatum; Tumor endothelial marker 2 RASD2 Rhes, TEM2 RASD family member 2 GTP-binding protein Rhes|Ras homolog enriched in striatum|tumor endothelial marker 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RASD2, check out the RASD2 Infographic

RASD2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RASD2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96D21

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RASD2 (NM_014310) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RASD2 (NM_014310) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RASD2 (NM_014310) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96D21
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.