Product Info Summary
SKU: | PB9879 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-DARPP32/PPP1R1B Antibody Picoband™
SKU/Catalog Number
PB9879
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-DARPP32/PPP1R1B Antibody Picoband™ catalog # PB9879. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-DARPP32/PPP1R1B Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9879)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9879 is reactive to Ppp1r1b in Human, Mouse, Rat
Applications
PB9879 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee
Observed Molecular Weight
32 kDa
Calculated molecular weight
22963 MW
Background of DARPP-32
Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human
Validation Images & Assay Conditions
![pb9879 darpp32 primary antibodies wb testing 1 pb9879 darpp32 primary antibodies wb testing 1](https://www.bosterbio.com/media/catalog/product/p/b/pb9879-darpp32-primary-antibodies-wb-testing-1.jpg)
Click image to see more details
Figure 1. Western blot analysis of DARPP32 using anti-DARPP32 antibody (PB9879).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human CACO-2 whole cell lysates,
Lane 2: rat brain tissue lysates,
Lane 3: mouse brain tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-DARPP32 antigen affinity purified polyclonal antibody (Catalog # PB9879) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for DARPP32 at approximately 32 kDa. The expected band size for DARPP32 is at 23 kDa.
![pb9879 2 IHC anti darpp32 picoband antibody pb9879 2 IHC anti darpp32 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/pb9879-2-IHC-anti-darpp32-picoband-antibody.jpg)
Click image to see more details
Figure 2. IHC analysis of DARPP32 using anti-DARPP32 antibody (PB9879).
DARPP32 was detected in a paraffin-embedded section of mouse pancreas tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-DARPP32 Antibody (PB9879) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
![pb9879 3 IHC anti darpp32 picoband antibody pb9879 3 IHC anti darpp32 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/pb9879-3-IHC-anti-darpp32-picoband-antibody.jpg)
Click image to see more details
Figure 3. IHC analysis of DARPP32 using anti-DARPP32 antibody (PB9879).
DARPP32 was detected in a paraffin-embedded section of rat intestine tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-DARPP32 Antibody (PB9879) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
![pb9879 4 IHC anti darpp32 picoband antibody pb9879 4 IHC anti darpp32 picoband antibody](https://www.bosterbio.com/media/catalog/product/antibody/pb9879-4-IHC-anti-darpp32-picoband-antibody.jpg)
Click image to see more details
Figure 4. IHC analysis of DARPP32 using anti-DARPP32 antibody (PB9879).
DARPP32 was detected in a paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-DARPP32 Antibody (PB9879) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
![pb9879 5 pb9879 5](https://www.bosterbio.com/media/catalog/product/p/b/pb9879-5.png)
Click image to see more details
Figure 5. Flow Cytometry analysis of THP-1 cells using anti-DARPP32 antibody (PB9879).
Overlay histogram showing THP-1 cells stained with PB9879 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-DARPP32 Antibody (PB9879,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
![pb9879 6 pb9879 6](https://www.bosterbio.com/media/catalog/product/p/b/pb9879-6.png)
Click image to see more details
Figure 6. Flow Cytometry analysis of PC-3 cells using anti-DARPP32 antibody (PB9879).
Overlay histogram showing PC-3 cells stained with PB9879 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-DARPP32 Antibody (PB9879,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For Ppp1r1b (Source: Uniprot.org, NCBI)
Gene Name
Ppp1r1b
Full Name
Protein phosphatase 1 regulatory subunit 1B
Weight
22963 MW
Superfamily
protein phosphatase inhibitor 1 family
Alternative Names
DARPP32; DARPP-32; PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B; regulatory (inhibitor) subunit 1B (dopamine and cAMPregulated phosphoprotein, DARPP-32) Ppp1r1b|AU040756, DARP, DARPP-32, Dar, Darpp32|protein phosphatase 1, regulatory inhibitor subunit 1B|protein phosphatase 1 regulatory subunit 1B|dopamine- and cAMP-regulated neuronal phosphoprotein
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on Ppp1r1b, check out the Ppp1r1b Infographic
![Ppp1r1b infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Ppp1r1b: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-DARPP32/PPP1R1B Antibody Picoband™ (PB9879)
Hello CJ!
No publications found for PB9879
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-DARPP32/PPP1R1B Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-DARPP32/PPP1R1B Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-DARPP32/PPP1R1B Antibody Picoband™
Question
I was wanting to use your anti-DARPP32/PPP1R1B antibody for WB for human brain on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human brain identification?
Verified Customer
Verified customer
Asked: 2020-02-17
Answer
As indicated on the product datasheet, PB9879 anti-DARPP32/PPP1R1B antibody has been validated for Flow Cytometry, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-02-17
Question
Do you have a BSA free version of anti-DARPP32/PPP1R1B antibody PB9879 available?
Verified Customer
Verified customer
Asked: 2019-11-19
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-DARPP32/PPP1R1B antibody PB9879 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-11-19
Question
Does anti-DARPP32/PPP1R1B antibody PB9879 work on zebrafish Flow Cytometry with adipose tissue?
Verified Customer
Verified customer
Asked: 2019-08-09
Answer
Our lab technicians have not validated anti-DARPP32/PPP1R1B antibody PB9879 on zebrafish. You can run a BLAST between zebrafish and the immunogen sequence of anti-DARPP32/PPP1R1B antibody PB9879 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated zebrafish samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in zebrafish adipose tissue in Flow Cytometry, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-08-09
Question
Is this PB9879 anti-DARPP32/PPP1R1B antibody reactive to the isotypes of PPP1R1B?
B. Lewis
Verified customer
Asked: 2019-07-26
Answer
The immunogen of PB9879 anti-DARPP32/PPP1R1B antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-07-26
Question
We are currently using anti-DARPP32/PPP1R1B antibody PB9879 for mouse tissue, and we are satisfied with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?
Verified Customer
Verified customer
Asked: 2018-01-30
Answer
The anti-DARPP32/PPP1R1B antibody (PB9879) has not been validated for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-01-30
Question
Will PB9879 anti-DARPP32/PPP1R1B antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
E. Singh
Verified customer
Asked: 2017-11-27
Answer
It shows on the product datasheet, PB9879 anti-DARPP32/PPP1R1B antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2017-11-27