Anti-DARPP32/PPP1R1B Antibody Picoband™

DARPP-32 antibody

Boster Bio Anti-DARPP32/PPP1R1B Antibody Picoband™ catalog # PB9879. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9879
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-DARPP32/PPP1R1B Antibody Picoband™

View all DARPP-32 Antibodies

SKU/Catalog Number

PB9879

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-DARPP32/PPP1R1B Antibody Picoband™ catalog # PB9879. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-DARPP32/PPP1R1B Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9879)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9879 is reactive to Ppp1r1b in Human, Mouse, Rat

Applications

PB9879 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Observed Molecular Weight

32 kDa

Calculated molecular weight

22963 MW

Background of DARPP-32

Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For Ppp1r1b (Source: Uniprot.org, NCBI)

Gene Name

Ppp1r1b

Full Name

Protein phosphatase 1 regulatory subunit 1B

Weight

22963 MW

Superfamily

protein phosphatase inhibitor 1 family

Alternative Names

DARPP32; DARPP-32; PPP1R1B; protein phosphatase 1, regulatory (inhibitor) subunit 1B; regulatory (inhibitor) subunit 1B (dopamine and cAMPregulated phosphoprotein, DARPP-32) Ppp1r1b|AU040756, DARP, DARPP-32, Dar, Darpp32|protein phosphatase 1, regulatory inhibitor subunit 1B|protein phosphatase 1 regulatory subunit 1B|dopamine- and cAMP-regulated neuronal phosphoprotein

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on Ppp1r1b, check out the Ppp1r1b Infographic

Ppp1r1b infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Ppp1r1b: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9879

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-DARPP32/PPP1R1B Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-DARPP32/PPP1R1B Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-DARPP32/PPP1R1B Antibody Picoband™

Question

I was wanting to use your anti-DARPP32/PPP1R1B antibody for WB for human brain on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human brain identification?

Verified Customer

Verified customer

Asked: 2020-02-17

Answer

As indicated on the product datasheet, PB9879 anti-DARPP32/PPP1R1B antibody has been validated for Flow Cytometry, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-02-17

Question

Do you have a BSA free version of anti-DARPP32/PPP1R1B antibody PB9879 available?

Verified Customer

Verified customer

Asked: 2019-11-19

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-DARPP32/PPP1R1B antibody PB9879 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-11-19

Question

Does anti-DARPP32/PPP1R1B antibody PB9879 work on zebrafish Flow Cytometry with adipose tissue?

Verified Customer

Verified customer

Asked: 2019-08-09

Answer

Our lab technicians have not validated anti-DARPP32/PPP1R1B antibody PB9879 on zebrafish. You can run a BLAST between zebrafish and the immunogen sequence of anti-DARPP32/PPP1R1B antibody PB9879 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated zebrafish samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in zebrafish adipose tissue in Flow Cytometry, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-08-09

Question

Is this PB9879 anti-DARPP32/PPP1R1B antibody reactive to the isotypes of PPP1R1B?

B. Lewis

Verified customer

Asked: 2019-07-26

Answer

The immunogen of PB9879 anti-DARPP32/PPP1R1B antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-07-26

Question

We are currently using anti-DARPP32/PPP1R1B antibody PB9879 for mouse tissue, and we are satisfied with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2018-01-30

Answer

The anti-DARPP32/PPP1R1B antibody (PB9879) has not been validated for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-01-30

Question

Will PB9879 anti-DARPP32/PPP1R1B antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

E. Singh

Verified customer

Asked: 2017-11-27

Answer

It shows on the product datasheet, PB9879 anti-DARPP32/PPP1R1B antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2017-11-27

Order DetailsPrice
PB9879

100μg

$370
PB9879-10ug

10μg sample (liquid)

$99
PB9879-Biotin

100 μg Biotin conjugated

$570
PB9879-Cy3

100 μg Cy3 conjugated

$570
PB9879-Dylight488

100 μg Dylight488 conjugated

$570
PB9879-Dylight550

100 μg Dylight550 conjugated

$570
PB9879-Dylight594

100 μg Dylight594 conjugated

$570
PB9879-FITC

100 μg FITC conjugated

$570
PB9879-HRP

100 μg HRP conjugated

$570
PB9879-APC

100 μg APC conjugated

$670
PB9879-PE

100 μg PE conjugated

$670
PB9879-iFluor647

100 μg iFluor647 conjugated

$670
PB9879-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9879
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.