QK1 (QKI) (NM_206854) Human Recombinant Protein

QKI/Quaking protein,

Product Info Summary

SKU: PROTQ96PU8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

QK1 (QKI) (NM_206854) Human Recombinant Protein

View all QKI/Quaking recombinant proteins

SKU/Catalog Number

PROTQ96PU8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human quaking homolog, KH domain RNA binding (mouse) (QKI), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

QK1 (QKI) (NM_206854) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96PU8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.8 kDa

Amino Acid Sequence

MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLEWIEMPVMPDISAH

Validation Images & Assay Conditions

Gene/Protein Information For QKI (Source: Uniprot.org, NCBI)

Gene Name

QKI

Full Name

Protein quaking

Weight

35.8 kDa

Alternative Names

DKFZp586I0923; HKQ; homolog of mouse quaking QKI (KH domain RNA binding protein); Hqk; hqkI; protein quaking; QK; QK1; QK3; quaking homolog, KH domain RNA binding (mouse); RNA binding protein HQK QKI Hqk, QK, QK1, QK3, hqkI QKI, KH domain containing RNA binding protein quaking|QKI/LOC100132735 fusion|RNA binding protein HQK|homolog of mouse quaking QKI (KH domain RNA binding protein)|quaking homolog, KH domain RNA binding

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on QKI, check out the QKI Infographic

QKI infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for QKI: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96PU8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used QK1 (QKI) (NM_206854) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For QK1 (QKI) (NM_206854) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for QK1 (QKI) (NM_206854) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96PU8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.