Pyrophosphatase 1 (PPA1) (NM_021129) Human Recombinant Protein

Inorganic Pyrophosphatase/PPA1 protein,

Product Info Summary

SKU: PROTQ15181
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Pyrophosphatase 1 (PPA1) (NM_021129) Human Recombinant Protein

View all Inorganic Pyrophosphatase/PPA1 recombinant proteins

SKU/Catalog Number

PROTQ15181

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human pyrophosphatase (inorganic) 1 (PPA1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Pyrophosphatase 1 (PPA1) (NM_021129) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15181)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.5 kDa

Amino Acid Sequence

MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN

Validation Images & Assay Conditions

Gene/Protein Information For PPA1 (Source: Uniprot.org, NCBI)

Gene Name

PPA1

Full Name

Inorganic pyrophosphatase

Weight

32.5 kDa

Superfamily

PPase family

Alternative Names

diphosphate phosphohydrolase; EC 3.6.1.1; inorganic diphosphatase; inorganic pyrophosphatase 1; inorganic pyrophosphatase; IOPPP; IOPPPMGC111556; IPP1; PP1; PPA1; PPase; PPcytosolic inorganic pyrophosphatase; pyrophosphatase (inorganic) 1; pyrophosphatase (inorganic); pyrophosphatase 1; Pyrophosphate phospho-hydrolase; SID6-8061 PPA1 HEL-S-66p, IOPPP, PP, PP1, SID6-8061 inorganic pyrophosphatase 1 inorganic pyrophosphatase|PPase|cytosolic inorganic pyrophosphatase|diphosphate phosphohydrolase|epididymis secretory sperm binding protein Li 66p|inorganic diphosphatase 1|pyrophosphatase (inorganic) 1|pyrophosphatase 1|pyrophosphate phospho-hydrolase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PPA1, check out the PPA1 Infographic

PPA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PPA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15181

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Pyrophosphatase 1 (PPA1) (NM_021129) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Pyrophosphatase 1 (PPA1) (NM_021129) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Pyrophosphatase 1 (PPA1) (NM_021129) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15181
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.